Recombinant Human NDUFA2 protein, GST-tagged
| Cat.No. : | NDUFA2-1222H |
| Product Overview : | Recombinant Human NDUFA2 protein(1-99 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-99 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | NDUFA2 |
| Synonyms | NDUFA2; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2; B8; complex I B8 subunit; NADH-ubiquinone oxidoreductase subunit CI-B8; CD14; CIB8; |
| Gene ID | 4695 |
| mRNA Refseq | NM_001185012 |
| Protein Refseq | NP_001171941 |
| MIM | 602137 |
| UniProt ID | O43678 |
| ◆ Recombinant Proteins | ||
| NDUFA2-5966M | Recombinant Mouse NDUFA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NDUFA2-733C | Recombinant Cynomolgus NDUFA2 Protein, His-tagged | +Inquiry |
| NDUFA2-10515M | Recombinant Mouse NDUFA2 Protein | +Inquiry |
| NDUFA2-2194H | Recombinant Human NDUFA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NDUFA2-2793R | Recombinant Rhesus Macaque NDUFA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NDUFA2-3921HCL | Recombinant Human NDUFA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA2 Products
Required fields are marked with *
My Review for All NDUFA2 Products
Required fields are marked with *
