Recombinant Human NDUFV2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NDUFV2-6595H |
Product Overview : | NDUFV2 MS Standard C13 and N15-labeled recombinant protein (NP_066552) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The NADH-ubiquinone oxidoreductase complex (complex I) of the mitochondrial respiratory chain catalyzes the transfer of electrons from NADH to ubiquinone, and consists of at least 43 subunits. The complex is located in the inner mitochondrial membrane. This gene encodes the 24 kDa subunit of complex I, and is involved in electron transfer. Mutations in this gene are implicated in Parkinson's disease, bipolar disorder, schizophrenia, and have been found in one case of early onset hypertrophic cardiomyopathy and encephalopathy. A non-transcribed pseudogene of this locus is found on chromosome 19. |
Molecular Mass : | 27.4 kDa |
AA Sequence : | MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NDUFV2 NADH:ubiquinone oxidoreductase core subunit V2 [ Homo sapiens (human) ] |
Official Symbol | NDUFV2 |
Synonyms | NDUFV2; NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa; NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD); NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial; CI 24k; complex I 24kDa subunit; NADH dehydrogenase [ubiquinone] flavoprotein 2; mitochondrial; NADH-ubiquinone oxidoreductase 24 kDa subunit; NADH-ubiquinone oxidoreductase flavoprotein 2; complex I, mitochondrial respitory chain, 24 kD subunit; NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial; nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit; CI-24k; |
Gene ID | 4729 |
mRNA Refseq | NM_021074 |
Protein Refseq | NP_066552 |
MIM | 600532 |
UniProt ID | P19404 |
◆ Recombinant Proteins | ||
NDUFV2-1244H | Recombinant Human NDUFV2, His-tagged | +Inquiry |
NDUFV2-3946R | Recombinant Rat NDUFV2 Protein | +Inquiry |
NDUFV2-2811R | Recombinant Rhesus Macaque NDUFV2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ndufv2-4349M | Recombinant Mouse Ndufv2 Protein, Myc/DDK-tagged | +Inquiry |
NDUFV2-10549M | Recombinant Mouse NDUFV2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFV2-3891HCL | Recombinant Human NDUFV2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFV2 Products
Required fields are marked with *
My Review for All NDUFV2 Products
Required fields are marked with *