Recombinant Human NECAB3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NECAB3-3455H
Product Overview : NECAB3 MS Standard C13 and N15-labeled recombinant protein (NP_112508) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 40.8 kDa
AA Sequence : MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NECAB3 N-terminal EF-hand calcium binding protein 3 [ Homo sapiens (human) ]
Official Symbol NECAB3
Synonyms NECAB3; N-terminal EF-hand calcium binding protein 3; amyloid beta (A4) precursor protein binding, family A, member 2 binding protein, APBA2BP, SYTIP2; N-terminal EF-hand calcium-binding protein 3; dJ63M2.4; dJ63M2.5; EF hand calcium binding protein 3; EFCBP3; NIP1; XB51; X11L-binding protein 51; Nek2-interacting protein 1; EF-hand calcium binding protein 3; neuronal calcium-binding protein 3; synaptotagmin interacting protein 2; neuronal calcium-binding protein NECAB3; synaptotagmin interacting protein STIP3; amyloid beta A4 protein-binding family A member 2-binding protein; amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein; STIP3; SYTIP2; APBA2BP;
Gene ID 63941
mRNA Refseq NM_031231
Protein Refseq NP_112508
MIM 612478
UniProt ID Q96P71

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NECAB3 Products

Required fields are marked with *

My Review for All NECAB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon