Recombinant Human NECAB3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NECAB3-3455H |
Product Overview : | NECAB3 MS Standard C13 and N15-labeled recombinant protein (NP_112508) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 40.8 kDa |
AA Sequence : | MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NECAB3 N-terminal EF-hand calcium binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | NECAB3 |
Synonyms | NECAB3; N-terminal EF-hand calcium binding protein 3; amyloid beta (A4) precursor protein binding, family A, member 2 binding protein, APBA2BP, SYTIP2; N-terminal EF-hand calcium-binding protein 3; dJ63M2.4; dJ63M2.5; EF hand calcium binding protein 3; EFCBP3; NIP1; XB51; X11L-binding protein 51; Nek2-interacting protein 1; EF-hand calcium binding protein 3; neuronal calcium-binding protein 3; synaptotagmin interacting protein 2; neuronal calcium-binding protein NECAB3; synaptotagmin interacting protein STIP3; amyloid beta A4 protein-binding family A member 2-binding protein; amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein; STIP3; SYTIP2; APBA2BP; |
Gene ID | 63941 |
mRNA Refseq | NM_031231 |
Protein Refseq | NP_112508 |
MIM | 612478 |
UniProt ID | Q96P71 |
◆ Recombinant Proteins | ||
NECAB3-10555M | Recombinant Mouse NECAB3 Protein | +Inquiry |
NECAB3-2545C | Recombinant Chicken NECAB3 | +Inquiry |
NECAB3-3455H | Recombinant Human NECAB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NECAB3-6000M | Recombinant Mouse NECAB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Necab3-4353M | Recombinant Mouse Necab3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NECAB3-3888HCL | Recombinant Human NECAB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NECAB3 Products
Required fields are marked with *
My Review for All NECAB3 Products
Required fields are marked with *