Recombinant Human NEDD4 protein, His-tagged
| Cat.No. : | NEDD4-2461H |
| Product Overview : | Recombinant Human NEDD4 protein(970-1319 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 970-1319 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NEDD4 neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase [ Homo sapiens ] |
| Official Symbol | NEDD4 |
| Synonyms | NEDD4; neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase; neural precursor cell expressed, developmentally down regulated 4; E3 ubiquitin-protein ligase NEDD4; KIAA0093; MGC176705; NEDD4 1; receptor potentiating factor 1; RPF1; NEDD-4; receptor-potentiating factor 1; cell proliferation-inducing gene 53 protein; neural precursor cell expressed developmentally down-regulated protein 4; NEDD4-1; |
| Gene ID | 4734 |
| mRNA Refseq | NM_006154 |
| Protein Refseq | NP_006145 |
| MIM | 602278 |
| UniProt ID | P46934 |
| ◆ Recombinant Proteins | ||
| NEDD4-2461H | Recombinant Human NEDD4 protein, His-tagged | +Inquiry |
| Nedd4-4359M | Recombinant Mouse Nedd4 Protein, Myc/DDK-tagged | +Inquiry |
| NEDD4-29278TH | Recombinant Human NEDD4, FLAG-tagged | +Inquiry |
| NEDD4-1252H | Recombinant Human NEDD4, GST-tagged | +Inquiry |
| NEDD4-01H | Active Recombinant Human NEDD4 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NEDD4-3886HCL | Recombinant Human NEDD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEDD4 Products
Required fields are marked with *
My Review for All NEDD4 Products
Required fields are marked with *
