Recombinant Human NEFL, GST-tagged
Cat.No. : | NEFL-12H |
Product Overview : | Recombinant Human NEFL(1 a.a. - 543 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. |
Molecular Mass : | 87.9 kDa |
AA Sequence : | MSSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQ VAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQEIRDLRLAA EDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEISFLKK VHEEEIAELQAQIQYAQISVEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRA AKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRTTKSEMARYLKEYQDL LNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEE QIEVEETIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEE EEKKVEGAGEEQAAKKKD |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NEFL neurofilament, light polypeptide [ Homo sapiens ] |
Official Symbol | NEFL |
Synonyms | NEFL; neurofilament, light polypeptide; neurofilament, light polypeptide 68kDa; neurofilament light polypeptide; CMT1F; CMT2E; NF68; NFL; neurofilament subunit NF-L; neurofilament triplet L protein; neurofilament protein, light chain; light molecular weig |
Gene ID | 4747 |
mRNA Refseq | NM_006158 |
Protein Refseq | NP_006149 |
MIM | 162280 |
UniProt ID | P07196 |
Chromosome Location | 8p21 |
Pathway | Activation of NMDA receptor upon glutamate binding and postsynaptic events; Amyotrophic lateral sclerosis (ALS); CREB phosphorylation through the activation of Ras |
Function | identical protein binding; phospholipase binding; protein C-terminus binding |
◆ Recombinant Proteins | ||
Nefl-6433M | Recombinant Mouse Nefl protein, His-tagged | +Inquiry |
NEFL-18H | Recombinant Human NEFL Protein,His-tagged | +Inquiry |
NEFL-2484H | Recombinant Human NEFL Protein, His-tagged | +Inquiry |
NEFL-17H | Recombinant Human NEFL Protein,His-tagged | +Inquiry |
NEFL-2815R | Recombinant Rhesus Macaque NEFL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
NEFL-181B | Native bovine NEFL | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEFL Products
Required fields are marked with *
My Review for All NEFL Products
Required fields are marked with *