Recombinant Human NEFL, His-tagged
Cat.No. : | NEFL-26033TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 391-543 of Human 68kDa Neurofilament, with a N-terminal His tag. MWt 37kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 391-543 a.a. |
Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 139 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTS SYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKD EPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAK EEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD |
Sequence Similarities : | Belongs to the intermediate filament family. |
Gene Name | NEFL neurofilament, light polypeptide [ Homo sapiens ] |
Official Symbol | NEFL |
Synonyms | NEFL; neurofilament, light polypeptide; neurofilament, light polypeptide 68kDa; neurofilament light polypeptide; CMT1F; CMT2E; NF68; NFL; |
Gene ID | 4747 |
mRNA Refseq | NM_006158 |
Protein Refseq | NP_006149 |
MIM | 162280 |
Uniprot ID | P07196 |
Chromosome Location | 8p21.2 |
Pathway | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; |
Function | identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton; |
◆ Recombinant Proteins | ||
Nefl-4363M | Recombinant Mouse Nefl Protein, Myc/DDK-tagged | +Inquiry |
Nefl-3271R | Recombinant Rat Nefl protein, His-tagged | +Inquiry |
NEFL-10563M | Recombinant Mouse Nefl Protein, Myc/DDK-tagged | +Inquiry |
NEFL-2573H | Recombinant Human NEFL protein(91-510 aa), C-His-tagged | +Inquiry |
Nefl-6433M | Recombinant Mouse Nefl protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
NEFL-181B | Native bovine NEFL | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a question
Can I get this product ""Recombinant Human NEFL, His-tagged
Cat.No. : NEFL-26033TH"" expressed in human cell (not in bacteria)?
NEFL-26033TH
10/04/2023
Sequence: a.a.391-543
Ask a Question for All NEFL Products
Required fields are marked with *
My Review for All NEFL Products
Required fields are marked with *
0
Inquiry Basket