Recombinant Human NEFL, His-tagged
| Cat.No. : | NEFL-26033TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 391-543 of Human 68kDa Neurofilament, with a N-terminal His tag. MWt 37kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 391-543 a.a. |
| Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 139 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTS SYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKD EPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAK EEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD |
| Sequence Similarities : | Belongs to the intermediate filament family. |
| Gene Name | NEFL neurofilament, light polypeptide [ Homo sapiens ] |
| Official Symbol | NEFL |
| Synonyms | NEFL; neurofilament, light polypeptide; neurofilament, light polypeptide 68kDa; neurofilament light polypeptide; CMT1F; CMT2E; NF68; NFL; |
| Gene ID | 4747 |
| mRNA Refseq | NM_006158 |
| Protein Refseq | NP_006149 |
| MIM | 162280 |
| Uniprot ID | P07196 |
| Chromosome Location | 8p21.2 |
| Pathway | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; |
| Function | identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton; |
| ◆ Recombinant Proteins | ||
| Nefl-343M | Recombinant Mouse Nefl protein, N/A-tagged | +Inquiry |
| NEFL-2996R | Recombinant Rhesus monkey NEFL Protein, His-tagged | +Inquiry |
| NEFL-7008HF | Recombinant Full Length Human NEFL Protein, GST-tagged | +Inquiry |
| NEFL-4533H | Recombinant Human NEFL protein, His-SUMO-tagged | +Inquiry |
| NEFL-13H | Recombinant Human NEFL protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| NEFL-181B | Native bovine NEFL | +Inquiry |
| NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All NEFL Products
Required fields are marked with *
My Review for All NEFL Products
Required fields are marked with *