Recombinant Human NEFL, His-tagged
Cat.No. : | NEFL-26033TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 391-543 of Human 68kDa Neurofilament, with a N-terminal His tag. MWt 37kDa; |
- Specification
- Gene Information
- Related Products
Description : | Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene encodes the light chain neurofilament protein. Mutations in this gene cause Charcot-Marie-Tooth disease types 1F (CMT1F) and 2E (CMT2E), disorders of the peripheral nervous system that are characterized by distinct neuropathies. A pseudogene has been identified on chromosome Y. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 139 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KLLEGEETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTS SYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKD EPPSEGEAEEEEKDKEEAEEEEAAEEEEAAKEESEEAK EEEEGGEGEEGEETKEAEEEEKKVEGAGEEQAAKKKD |
Sequence Similarities : | Belongs to the intermediate filament family. |
Gene Name : | NEFL neurofilament, light polypeptide [ Homo sapiens ] |
Official Symbol : | NEFL |
Synonyms : | NEFL; neurofilament, light polypeptide; neurofilament, light polypeptide 68kDa; neurofilament light polypeptide; CMT1F; CMT2E; NF68; NFL; |
Gene ID : | 4747 |
mRNA Refseq : | NM_006158 |
Protein Refseq : | NP_006149 |
MIM : | 162280 |
Uniprot ID : | P07196 |
Chromosome Location : | 8p21.2 |
Pathway : | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; |
Function : | identical protein binding; protein C-terminus binding; protein binding; structural constituent of cytoskeleton; |
Products Types
◆ Recombinant Protein | ||
NEFL-2815R | Recombinant Rhesus Macaque NEFL Protein, His (Fc)-Avi-tagged | +Inquiry |
NEFL-2484H | Recombinant Human NEFL Protein, His-tagged | +Inquiry |
NEFL-23H | Recombinant Human NEFL Protein, His-tagged | +Inquiry |
NEFL-2574H | Recombinant Human NEFL protein(11-350 aa), N-MBP & C-His-tagged | +Inquiry |
NEFL-10563M | Recombinant Mouse Nefl Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Protein | ||
NEFL-181B | Native bovine NEFL | +Inquiry |
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
◆ Lysates | ||
NEFL-3884HCL | Recombinant Human NEFL 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket