Recombinant Human NEIL2 protein, His-tagged
Cat.No. : | NEIL2-3048H |
Product Overview : | Recombinant Human NEIL2 protein(239 - 332 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 239 - 332 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | YRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NEIL2 nei endonuclease VIII-like 2 (E. coli) [ Homo sapiens ] |
Official Symbol | NEIL2 |
Synonyms | NEIL2; nei endonuclease VIII-like 2 (E. coli); nei like 2 (E. coli); endonuclease 8-like 2; FLJ31644; MGC2832; MGC4505; NEH2; nei like 2; nei homolog 2; nei-like protein 2; endonuclease VIII-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; NEI2; |
Gene ID | 252969 |
mRNA Refseq | NM_001135746 |
Protein Refseq | NP_001129218 |
MIM | 608933 |
UniProt ID | Q969S2 |
◆ Recombinant Proteins | ||
NEIL2-5185C | Recombinant Chicken NEIL2 | +Inquiry |
NEIL2-351H | Recombinant Human NEIL2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NEIL2-586H | Recombinant Human Nei Endonuclease VIII-like 2 (E. coli) | +Inquiry |
NEIL2 -1542H | Recombinant Human NEIL2 protein | +Inquiry |
NEIL2-1963H | Recombinant Human Nei Endonuclease VIII-like 2 (E. coli), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEIL2-3881HCL | Recombinant Human NEIL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NEIL2 Products
Required fields are marked with *
My Review for All NEIL2 Products
Required fields are marked with *
0
Inquiry Basket