Recombinant Human NEIL2 protein, His-tagged

Cat.No. : NEIL2-3048H
Product Overview : Recombinant Human NEIL2 protein(239 - 332 aa), fused to His tag, was expressed in E. coli.
Availability August 24, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 239 - 332 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : YRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NEIL2 nei endonuclease VIII-like 2 (E. coli) [ Homo sapiens ]
Official Symbol NEIL2
Synonyms NEIL2; nei endonuclease VIII-like 2 (E. coli); nei like 2 (E. coli); endonuclease 8-like 2; FLJ31644; MGC2832; MGC4505; NEH2; nei like 2; nei homolog 2; nei-like protein 2; endonuclease VIII-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; NEI2;
Gene ID 252969
mRNA Refseq NM_001135746
Protein Refseq NP_001129218
MIM 608933
UniProt ID Q969S2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NEIL2 Products

Required fields are marked with *

My Review for All NEIL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon