Recombinant Human NEIL2 protein, His-tagged

• Cat.No.: NEIL2-3048H
• Product Overview: Recombinant Human NEIL2 protein(239 - 332 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 239 - 332 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: YRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NEIL2 nei endonuclease VIII-like 2 (E. coli) [ Homo sapiens ]
• Official Symbol: NEIL2
• Synonyms: NEIL2; nei endonuclease VIII-like 2 (E. coli); nei like 2 (E. coli); endonuclease 8-like 2; FLJ31644; MGC2832; MGC4505; NEH2; nei like 2; nei homolog 2; nei-like protein 2; endonuclease VIII-like 2; DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; NEI2
• Gene ID: 252969
• mRNA Refseq: NM_001135746
• Protein Refseq: NP_001129218
• MIM: 608933
• UniProt ID: Q969S2