Recombinant Human NEK7 protein(1-302aa), His-SUMO-tagged
| Cat.No. : | NEK7-6161H |
| Product Overview : | Recombinant Human NEK7 protein(Q8TDX7)(1-302aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-302aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 47.5 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS |
| Gene Name | NEK7 NIMA (never in mitosis gene a)-related kinase 7 [ Homo sapiens ] |
| Official Symbol | NEK7 |
| Synonyms | NEK7; NIMA (never in mitosis gene a)-related kinase 7; serine/threonine-protein kinase Nek7; nimA-related protein kinase 7; never in mitosis A-related kinase 7; |
| Gene ID | 140609 |
| mRNA Refseq | NM_133494 |
| Protein Refseq | NP_598001 |
| MIM | 606848 |
| UniProt ID | Q8TDX7 |
| ◆ Recombinant Proteins | ||
| NEK7-28259TH | Recombinant Human NEK7 | +Inquiry |
| NEK7-371H | Recombinant Human NEK7, GST-tagged, Active | +Inquiry |
| NEK7-816H | Recombinant Human NEK7 | +Inquiry |
| NEK7-3613R | Recombinant Rat NEK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NEK7-2818R | Recombinant Rhesus Macaque NEK7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NEK7-254HKCL | Human NEK7 Knockdown Cell Lysate | +Inquiry |
| NEK7-654HCL | Recombinant Human NEK7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEK7 Products
Required fields are marked with *
My Review for All NEK7 Products
Required fields are marked with *
