Recombinant Human NFKB1 protein, His-tagged
| Cat.No. : | NFKB1-3973H |
| Product Overview : | Recombinant Human NFKB1 protein(1-368 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-368 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLM |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ] |
| Official Symbol | NFKB1 |
| Synonyms | NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NF kB1; NFkappaB; NFKB p50; p50; p105; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit; EBP-1; NF-kB1; NFKB-p50; NF-kappaB; NFKB-p105; NF-kappa-B; MGC54151; DKFZp686C01211; |
| Gene ID | 4790 |
| mRNA Refseq | NM_001165412 |
| Protein Refseq | NP_001158884 |
| MIM | 164011 |
| UniProt ID | P19838 |
| ◆ Recombinant Proteins | ||
| NFKB1-3973H | Recombinant Human NFKB1 protein, His-tagged | +Inquiry |
| NFKB1-1846C | Recombinant Chicken NFKB1 protein, His & T7-tagged | +Inquiry |
| NFKB1-310H | Recombinant Human NFKB1 protein, His/MBP-tagged | +Inquiry |
| NFKB1-300H | Recombinant Human NFKB1 protein, MYC/DDK-tagged | +Inquiry |
| NFKB1-6691C | Recombinant Chicken NFKB1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFKB1-255HKCL | Human NFKB1 Knockdown Cell Lysate | +Inquiry |
| NFKB1-3850HCL | Recombinant Human NFKB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFKB1 Products
Required fields are marked with *
My Review for All NFKB1 Products
Required fields are marked with *
