Recombinant Human NFKB1 protein, His-tagged

Cat.No. : NFKB1-563H
Product Overview : Recombinant Human NFKB1 protein(P19838)(1-433aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-433a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG
Gene Name NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ]
Official Symbol NFKB1
Synonyms NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NF kB1; NFkappaB; NFKB p50; p50; p105; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit; EBP-1; NF-kB1; NFKB-p50; NF-kappaB; NFKB-p105; NF-kappa-B; MGC54151; DKFZp686C01211;
Gene ID 4790
mRNA Refseq NM_001165412
Protein Refseq NP_001158884
MIM 164011
UniProt ID P19838

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFKB1 Products

Required fields are marked with *

My Review for All NFKB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon