Recombinant Human NFKB1 protein, T7/His-tagged
| Cat.No. : | NFKB1-120H |
| Product Overview : | Recombinant human NFkB p50 subunit cDNA (2 - 433aa, derived from BC051765) fused with T7/His/TEV cleavage site 29aa Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Protein Length : | 2-433 a.a. |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQI LEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDG ICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELI RQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLL CDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKP FLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHP GTTKSNAGMKHG |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro human NFkB functional regulations study using NFkB p50 subunit protein mediated intracellular delivery.2. May be used as specific substrate protein for kinase and ubiquitin related enzyme functional screening assays.3. May be used as antigen for specific antibody production. |
| Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ] |
| Official Symbol | NFKB1 |
| Synonyms | NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 |
| Gene ID | 4790 |
| mRNA Refseq | NM_001165412 |
| Protein Refseq | NP_001158884 |
| MIM | 164011 |
| UniProt ID | P19838 |
| Chromosome Location | 4q24 |
| Pathway | Activated TLR4 signalling, organism-specific biosystem; Activation of NF-kappaB in B Cells, organism-specific biosystem; Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adaptive Immune System, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; |
| Function | nucleic acid binding transcription factor activity; protein binding; regulatory region DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding; |
| ◆ Recombinant Proteins | ||
| NFKB1-2834R | Recombinant Rhesus Macaque NFKB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NFKB1-343HF | Recombinant Full Length Human NFKB1 Protein | +Inquiry |
| NFKB1-5260H | Recombinant Human NFKB1 protein, GST-tagged | +Inquiry |
| Nfkb1-1849R | Recombinant Rat Nfkb1 protein, His & GST-tagged | +Inquiry |
| NFKB1-563H | Recombinant Human NFKB1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NFKB1-3850HCL | Recombinant Human NFKB1 293 Cell Lysate | +Inquiry |
| NFKB1-255HKCL | Human NFKB1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFKB1 Products
Required fields are marked with *
My Review for All NFKB1 Products
Required fields are marked with *
