Recombinant Human NGB protein, His-SUMO-tagged
Cat.No. : | NGB-3275H |
Product Overview : | Recombinant Human NGB protein(Q9NPG2)(1-151aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-151aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.9 kDa |
AA Sequence : | MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | NGB neuroglobin [ Homo sapiens ] |
Official Symbol | NGB |
Synonyms | NGB; neuroglobin; |
Gene ID | 58157 |
mRNA Refseq | NM_021257 |
Protein Refseq | NP_067080 |
MIM | 605304 |
UniProt ID | Q9NPG2 |
◆ Recombinant Proteins | ||
NGB-3021R | Recombinant Rhesus monkey NGB Protein, His-tagged | +Inquiry |
Ngb-2650M | Recombinant Mouse Ngb protein, His-tagged | +Inquiry |
NGB-2840R | Recombinant Rhesus Macaque NGB Protein, His (Fc)-Avi-tagged | +Inquiry |
NGB-1854H | Recombinant Human NGB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ngb-4404M | Recombinant Mouse Ngb Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGB-3837HCL | Recombinant Human NGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGB Products
Required fields are marked with *
My Review for All NGB Products
Required fields are marked with *