Recombinant Human NGF protein(131-230 aa), N-SUMO & C-His-tagged

• Cat.No.: NGF-2511H
• Product Overview: Recombinant Human NGF protein(P01138)(131-230 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 131-230 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: GEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACV

Gene Information

• Gene Name: NGF nerve growth factor (beta polypeptide) [ Homo sapiens ]
• Official Symbol: NGF
• Synonyms: NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428
• Gene ID: 4803
• mRNA Refseq: NM_002506
• Protein Refseq: NP_002497
• MIM: 162030
• UniProt ID: P01138