Recombinant Human NGF protein(131-230 aa), N-SUMO & C-His-tagged
| Cat.No. : | NGF-2511H |
| Product Overview : | Recombinant Human NGF protein(P01138)(131-230 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 131-230 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACV |
| Gene Name | NGF nerve growth factor (beta polypeptide) [ Homo sapiens ] |
| Official Symbol | NGF |
| Synonyms | NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428; |
| Gene ID | 4803 |
| mRNA Refseq | NM_002506 |
| Protein Refseq | NP_002497 |
| MIM | 162030 |
| UniProt ID | P01138 |
| ◆ Recombinant Proteins | ||
| NGF-1869H | Recombinant Human Nerve Growth Factor (beta polypeptide) | +Inquiry |
| NGF-214M | Active Recombinant Mouse beta-NGF Protein | +Inquiry |
| NGF-234H | Active Recombinant Human NGF Protein (Ser122-Ala241), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| NGF-1155H | Recombinant Horse NGF Protein, His-tagged | +Inquiry |
| NGF-091H | Active Recombinant Human NGF Protein | +Inquiry |
| ◆ Native Proteins | ||
| Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
| Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
| Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
| NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *
