Recombinant Human NGF protein(131-230 aa), N-SUMO & C-His-tagged

Cat.No. : NGF-2511H
Product Overview : Recombinant Human NGF protein(P01138)(131-230 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 131-230 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : GEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACV
Gene Name NGF nerve growth factor (beta polypeptide) [ Homo sapiens ]
Official Symbol NGF
Synonyms NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428;
Gene ID 4803
mRNA Refseq NM_002506
Protein Refseq NP_002497
MIM 162030
UniProt ID P01138

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NGF Products

Required fields are marked with *

My Review for All NGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon