Recombinant Human NGF protein
Cat.No. : | NGF-588H |
Product Overview : | Recombinant Human NGF(Ser122-Arg239) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Protein Length : | Ser122-Arg239 |
Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 250mM NaCl, pH 7.0 |
AA Sequence : | SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKH WNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Gene Name | NGF nerve growth factor (beta polypeptide) [ Homo sapiens ] |
Official Symbol | NGF |
Synonyms | NGF; nerve growth factor (beta polypeptide); NGFB; beta-nerve growth factor; nerve growth factor, beta subunit; HSAN5; Beta-NGF; MGC161426; MGC161428; |
Gene ID | 4803 |
mRNA Refseq | NM_002506 |
Protein Refseq | NP_002497 |
MIM | 162030 |
UniProt ID | P01138 |
Chromosome Location | 1p13.1 |
Pathway | ARMS-mediated activation, organism-specific biosystem; Activation of TRKA receptors, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Axonal growth stimulation, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; Ceramide signalling, organism-specific biosystem; |
Function | growth factor activity; nerve growth factor receptor binding; receptor signaling protein activity; |
◆ Recombinant Proteins | ||
NGF-4702H | Recombinant Human NGF Protein (Glu19-Ala241) | +Inquiry |
NGF-28H | Recombinant Human Nerve Growth Factor (Beta Polypeptide) | +Inquiry |
NGF-1314H | Recombinant Human NGF Protein (Ser122-Arg239) | +Inquiry |
NGF-3313M | Recombinant Mouse NGF protein, His-GST-tagged | +Inquiry |
Ngf-477M | Recombinant Mouse Ngf protein(Ser122-Gly241) | +Inquiry |
◆ Native Proteins | ||
Ngf-51M | Native Mouse Nerve Growth Factor 2.5S | +Inquiry |
Ngf-182M | Active Native Mouse Ngf Protein | +Inquiry |
Ngf-298M | Active Native Mouse Nerve Growth Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
NGF-001MCL | Recombinant Mouse NGF cell lysate | +Inquiry |
NGF-001HCL | Recombinant Human NGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGF Products
Required fields are marked with *
My Review for All NGF Products
Required fields are marked with *
0
Inquiry Basket