Recombinant Human NGF Protein

Cat.No. : NGF-145H
Product Overview : Recombinant Human pro-Nerve Growth Factor is produced by our E.coli expression system and the target gene encoding Glu19-Ala241 is expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : Glu19-Ala241
Description : The precursor form of the nerve growth factor (proNGF) like its mature form is characterized by the cystin knot motif consisting of three cystine bridges, whereas proneurotrophins and mature neurotrophins elicit opposite biological effects. ProNGF functions preferentially via the complex of pan-neurotrophin receptor p75 (p75NTR) and vps10p domain-containing receptor sortilin inducing neuronal apoptosis and contributing to age- and disease-related neurodegeneration.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PB, 250mM NaCl, pH 7.2.
AA Sequence : MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRS PRVLFSTQPPREAADT QDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNIN NSVFKQYFFETKCRDPN PVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100μg/ml.
Dissolve the lyophilized protein in distilled water.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name NGF nerve growth factor [ Homo sapiens (human) ]
Official Symbol NGF
Synonyms Beta-Nerve Growth Factor; Beta-NGF; NGFB; HSAN5
Gene ID 4803
mRNA Refseq NM_002506.3
Protein Refseq NP_002497.2
MIM 162030
UniProt ID P01138

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NGF Products

Required fields are marked with *

My Review for All NGF Products

Required fields are marked with *

0
cart-icon
0
compare icon