Recombinant Human NIT2
Cat.No. : | NIT2-26962TH |
Product Overview : | Recombinant full length Human NIT2 expressed in Saccharomyces cerevisiae; 276 amino acids, MWt 30.6 kDa. Protein is tagged with a 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | Omega-amidase NIT2, also known NIT2, belongs to the nitrilase superfamily. This protein has an omega-amidase activity. |
Tissue specificity : | Detected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVS LPECFNSPYGAKYFPEYAEKIPGESTQKLSEVAKECSI YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDM RFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRS RAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVE MKKP |
Sequence Similarities : | Belongs to the UPF0012 family.Contains 1 CN hydrolase domain. |
Full Length : | Full L. |
Gene Name | NIT2 nitrilase family, member 2 [ Homo sapiens ] |
Official Symbol | NIT2 |
Synonyms | NIT2; nitrilase family, member 2; omega-amidase NIT2; |
Gene ID | 56954 |
mRNA Refseq | NM_020202 |
Protein Refseq | NP_064587 |
Uniprot ID | Q9NQR4 |
Chromosome Location | 3q12.3 |
Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; |
Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; molecular_function; omega-amidase activity; |
◆ Recombinant Proteins | ||
NIT2-1514H | Recombinant Human NIT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIT2-6078M | Recombinant Mouse NIT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIT2-1471A | Recombinant Arabidopsis thaliana NIT2 Protein (M1-K339), His-tagged | +Inquiry |
NIT2-3650R | Recombinant Rat NIT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIT2-6644HF | Recombinant Full Length Human NIT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIT2-3823HCL | Recombinant Human NIT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIT2 Products
Required fields are marked with *
My Review for All NIT2 Products
Required fields are marked with *
0
Inquiry Basket