Recombinant Human NIT2
| Cat.No. : | NIT2-26962TH |
| Product Overview : | Recombinant full length Human NIT2 expressed in Saccharomyces cerevisiae; 276 amino acids, MWt 30.6 kDa. Protein is tagged with a 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Description : | Omega-amidase NIT2, also known NIT2, belongs to the nitrilase superfamily. This protein has an omega-amidase activity. |
| Tissue specificity : | Detected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVS LPECFNSPYGAKYFPEYAEKIPGESTQKLSEVAKECSI YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDM RFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRS RAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVE MKKP |
| Sequence Similarities : | Belongs to the UPF0012 family.Contains 1 CN hydrolase domain. |
| Full Length : | Full L. |
| Gene Name | NIT2 nitrilase family, member 2 [ Homo sapiens ] |
| Official Symbol | NIT2 |
| Synonyms | NIT2; nitrilase family, member 2; omega-amidase NIT2; |
| Gene ID | 56954 |
| mRNA Refseq | NM_020202 |
| Protein Refseq | NP_064587 |
| Uniprot ID | Q9NQR4 |
| Chromosome Location | 3q12.3 |
| Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; |
| Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; molecular_function; omega-amidase activity; |
| ◆ Recombinant Proteins | ||
| NIT2-10682M | Recombinant Mouse NIT2 Protein | +Inquiry |
| NIT2-1471A | Recombinant Arabidopsis thaliana NIT2 Protein (M1-K339), His-tagged | +Inquiry |
| Nit2-4420M | Recombinant Mouse Nit2 Protein, Myc/DDK-tagged | +Inquiry |
| NIT2-26962TH | Recombinant Human NIT2 | +Inquiry |
| NIT2-5881H | Recombinant Human NIT2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NIT2-3823HCL | Recombinant Human NIT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIT2 Products
Required fields are marked with *
My Review for All NIT2 Products
Required fields are marked with *
