Recombinant Human NIT2
| Cat.No. : | NIT2-26962TH | 
| Product Overview : | Recombinant full length Human NIT2 expressed in Saccharomyces cerevisiae; 276 amino acids, MWt 30.6 kDa. Protein is tagged with a 26 kDa proprietary tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Tag : | Non | 
| Description : | Omega-amidase NIT2, also known NIT2, belongs to the nitrilase superfamily. This protein has an omega-amidase activity. | 
| Tissue specificity : | Detected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon. | 
| Form : | Liquid | 
| Purity : | >90% by SDS-PAGE | 
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVS LPECFNSPYGAKYFPEYAEKIPGESTQKLSEVAKECSI YLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDM RFAELAQIYAQRGCQLLVYPGAFNLTTGPAHWELLQRS RAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEAIVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVE MKKP | 
| Sequence Similarities : | Belongs to the UPF0012 family.Contains 1 CN hydrolase domain. | 
| Full Length : | Full L. | 
| Gene Name | NIT2 nitrilase family, member 2 [ Homo sapiens ] | 
| Official Symbol | NIT2 | 
| Synonyms | NIT2; nitrilase family, member 2; omega-amidase NIT2; | 
| Gene ID | 56954 | 
| mRNA Refseq | NM_020202 | 
| Protein Refseq | NP_064587 | 
| Uniprot ID | Q9NQR4 | 
| Chromosome Location | 3q12.3 | 
| Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; | 
| Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds; molecular_function; omega-amidase activity; | 
| ◆ Recombinant Proteins | ||
| NIT2-1514H | Recombinant Human NIT2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| NIT2-6078M | Recombinant Mouse NIT2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| NIT2-11648Z | Recombinant Zebrafish NIT2 | +Inquiry | 
| NIT2-10682M | Recombinant Mouse NIT2 Protein | +Inquiry | 
| NIT2-26965TH | Recombinant Human NIT2, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NIT2-3823HCL | Recombinant Human NIT2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NIT2 Products
Required fields are marked with *
My Review for All NIT2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            