Recombinant Human NKTR Protein (10-175 aa), His-SUMO-tagged

Cat.No. : NKTR-686H
Product Overview : Recombinant Human NKTR Protein (10-175 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 10-175 aa
Description : Component of a putative tumor-recognition complex. Involved in the function of NK cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 34.4 kDa
AA Sequence : HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name NKTR natural killer-tumor recognition sequence [ Homo sapiens ]
Official Symbol NKTR
Synonyms p104;
Gene ID 4820
mRNA Refseq NM_005385.3
Protein Refseq NP_005376.2
MIM 161565
UniProt ID P30414

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKTR Products

Required fields are marked with *

My Review for All NKTR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon