Recombinant Human NKTR Protein (10-175 aa), His-SUMO-tagged
Cat.No. : | NKTR-686H |
Product Overview : | Recombinant Human NKTR Protein (10-175 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 10-175 aa |
Description : | Component of a putative tumor-recognition complex. Involved in the function of NK cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 34.4 kDa |
AA Sequence : | HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | NKTR natural killer-tumor recognition sequence [ Homo sapiens ] |
Official Symbol | NKTR |
Synonyms | p104; |
Gene ID | 4820 |
mRNA Refseq | NM_005385.3 |
Protein Refseq | NP_005376.2 |
MIM | 161565 |
UniProt ID | P30414 |
◆ Recombinant Proteins | ||
NKTR-2716H | Recombinant Human NKTR protein(991-1120 aa), C-His-tagged | +Inquiry |
NKTR-686H | Recombinant Human NKTR Protein (10-175 aa), His-SUMO-tagged | +Inquiry |
NKTR-5895H | Recombinant Human NKTR Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKTR Products
Required fields are marked with *
My Review for All NKTR Products
Required fields are marked with *
0
Inquiry Basket