Recombinant Human NKTR Protein, GST-tagged
Cat.No. : | NKTR-5895H |
Product Overview : | Human NKTR partial ORF ( NP_005376.2, 888 a.a. - 984 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2 activation of the cells. [provided by RefSeq |
Molecular Mass : | 36.41 kDa |
AA Sequence : | ESNSERDVTKNSKNDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHGSKEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKTR natural killer-tumor recognition sequence [ Homo sapiens ] |
Official Symbol | NKTR |
Synonyms | p104; NKTR; natural killer-tumor recognition sequence |
Gene ID | 4820 |
mRNA Refseq | NM_005385 |
Protein Refseq | NP_005376 |
MIM | 161565 |
UniProt ID | P30414 |
◆ Recombinant Proteins | ||
NKTR-2716H | Recombinant Human NKTR protein(991-1120 aa), C-His-tagged | +Inquiry |
NKTR-686H | Recombinant Human NKTR Protein (10-175 aa), His-SUMO-tagged | +Inquiry |
NKTR-5895H | Recombinant Human NKTR Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKTR Products
Required fields are marked with *
My Review for All NKTR Products
Required fields are marked with *