Recombinant Human NKTR Protein, GST-tagged

Cat.No. : NKTR-5895H
Product Overview : Human NKTR partial ORF ( NP_005376.2, 888 a.a. - 984 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a membrane-anchored protein with a hydrophobic amino terminal domain and a cyclophilin-like PPIase domain. It is present on the surface of natural killer cells and facilitates their binding to targets. Its expression is regulated by IL2 activation of the cells. [provided by RefSeq
Molecular Mass : 36.41 kDa
AA Sequence : ESNSERDVTKNSKNDSHPSSDKEEGEATSDSESEVSEIHIKVKPTTKSSTNTSLPDDNGAWKSSKQRTSTSDSEGSCSNSENNRGKPQKHKHGSKEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKTR natural killer-tumor recognition sequence [ Homo sapiens ]
Official Symbol NKTR
Synonyms p104; NKTR; natural killer-tumor recognition sequence
Gene ID 4820
mRNA Refseq NM_005385
Protein Refseq NP_005376
MIM 161565
UniProt ID P30414

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKTR Products

Required fields are marked with *

My Review for All NKTR Products

Required fields are marked with *

0
cart-icon