Recombinant Human NKX2-2 Protein, GST-tagged
| Cat.No. : | NKX2-2-5896H |
| Product Overview : | Human NKX2-2 full-length ORF ( ABZ92170.1, 1 a.a. - 273 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-273 a.a. |
| Description : | The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. [provided by RefSeq |
| Molecular Mass : | 30.1 kDa |
| AA Sequence : | MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NKX2-2 NK2 homeobox 2 [ Homo sapiens ] |
| Official Symbol | NKX2-2 |
| Synonyms | NKX2-2; NK2 homeobox 2; NK 2 (Drosophila) homolog B , NK2 transcription factor related, locus 2 (Drosophila) , NKX2B; homeobox protein Nkx-2.2; NKX2.2; NK-2 homolog B; homeobox protein NK-2 homolog B; NK2 transcription factor-like protein B; NK2 transcription factor related, locus 2; NKX2B; |
| Gene ID | 4821 |
| mRNA Refseq | NM_002509 |
| Protein Refseq | NP_002500 |
| MIM | 604612 |
| UniProt ID | O95096 |
| ◆ Recombinant Proteins | ||
| NKX2-2-6676HF | Recombinant Full Length Human NKX2-2 Protein, GST-tagged | +Inquiry |
| NKX2-2-332H | Recombinant Human NKX2-2 Protein, His-tagged | +Inquiry |
| NKX2-2-5896H | Recombinant Human NKX2-2 Protein, GST-tagged | +Inquiry |
| NKX2-2-1303H | Recombinant Human NKX2-2, GST-tagged | +Inquiry |
| NKX2-2-153H | Recombinant Human NK2 homeobox 2 Protein, His&Flag&StrepII tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-2 Products
Required fields are marked with *
My Review for All NKX2-2 Products
Required fields are marked with *
