Recombinant Human NKX2-2 protein, His-tagged
| Cat.No. : | NKX2-2-3805H |
| Product Overview : | Recombinant Human NKX2-2 protein(1-129 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 27, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-129 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NKX2-2 NK2 homeobox 2 [ Homo sapiens ] |
| Official Symbol | NKX2-2 |
| Synonyms | NKX2-2; NK2 homeobox 2; NK 2 (Drosophila) homolog B , NK2 transcription factor related, locus 2 (Drosophila) , NKX2B; homeobox protein Nkx-2.2; NKX2.2; NK-2 homolog B; homeobox protein NK-2 homolog B; NK2 transcription factor-like protein B; NK2 transcription factor related, locus 2; NKX2B; |
| Gene ID | 4821 |
| mRNA Refseq | NM_002509 |
| Protein Refseq | NP_002500 |
| MIM | 604612 |
| UniProt ID | O95096 |
| ◆ Recombinant Proteins | ||
| NKX2-2-3805H | Recombinant Human NKX2-2 protein, His-tagged | +Inquiry |
| NKX2-2-5090C | Recombinant Chicken NKX2-2 | +Inquiry |
| NKX2-2-332H | Recombinant Human NKX2-2 Protein, His-tagged | +Inquiry |
| NKX2-2-153H | Recombinant Human NK2 homeobox 2 Protein, His&Flag&StrepII tagged | +Inquiry |
| NKX2-2-6676HF | Recombinant Full Length Human NKX2-2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX2-2 Products
Required fields are marked with *
My Review for All NKX2-2 Products
Required fields are marked with *
