Recombinant Human NKX2-8 Protein, GST-tagged
Cat.No. : | NKX2-8-5901H |
Product Overview : | Human NKX2-8 full-length ORF ( NP_055175.2, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-239 a.a. |
Description : | The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in some lung cancers and is linked to poor patient survival, possibly due to its resistance to cisplatin. This gene is aberrantly methylated in pancreatic cancer, deleted in squamous cell lung carcinomas, and acts as a tumor suppressor in esophageal cancer. Mutations in this gene may also be a cause of neural tube defects. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 52.3 kDa |
AA Sequence : | MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKX2-8 NK2 homeobox 8 [ Homo sapiens ] |
Official Symbol | NKX2-8 |
Synonyms | NKX2-8; NK2 homeobox 8; NK 2 homolog H (Drosophila) , NK2 transcription factor related, locus 8 (Drosophila) , NKX2H; homeobox protein Nkx-2.8; Nkx2 9; NKX2.8; NK-2 homolog 8; NK-2 homolog H; homeobox protein NK-2 homolog H; NK2 transcription factor related, locus 8; NKX2H; Nkx2-9; |
Gene ID | 26257 |
mRNA Refseq | NM_014360 |
Protein Refseq | NP_055175 |
MIM | 603245 |
UniProt ID | O15522 |
◆ Recombinant Proteins | ||
NKX2-8-5901H | Recombinant Human NKX2-8 Protein, GST-tagged | +Inquiry |
NKX2-8-2497H | Recombinant Human NKX2-8 protein, His-tagged | +Inquiry |
NKX2-8-6704HF | Recombinant Full Length Human NKX2-8 Protein, GST-tagged | +Inquiry |
NKX2-8-1304H | Recombinant Human NKX2-8, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKX2-8-1199HCL | Recombinant Human NKX2-8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX2-8 Products
Required fields are marked with *
My Review for All NKX2-8 Products
Required fields are marked with *
0
Inquiry Basket