Recombinant Human NKX2-8 Protein, GST-tagged

Cat.No. : NKX2-8-5901H
Product Overview : Human NKX2-8 full-length ORF ( NP_055175.2, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-239 a.a.
Description : The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in some lung cancers and is linked to poor patient survival, possibly due to its resistance to cisplatin. This gene is aberrantly methylated in pancreatic cancer, deleted in squamous cell lung carcinomas, and acts as a tumor suppressor in esophageal cancer. Mutations in this gene may also be a cause of neural tube defects. [provided by RefSeq, Dec 2015]
Molecular Mass : 52.3 kDa
AA Sequence : MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKX2-8 NK2 homeobox 8 [ Homo sapiens ]
Official Symbol NKX2-8
Synonyms NKX2-8; NK2 homeobox 8; NK 2 homolog H (Drosophila) , NK2 transcription factor related, locus 8 (Drosophila) , NKX2H; homeobox protein Nkx-2.8; Nkx2 9; NKX2.8; NK-2 homolog 8; NK-2 homolog H; homeobox protein NK-2 homolog H; NK2 transcription factor related, locus 8; NKX2H; Nkx2-9;
Gene ID 26257
mRNA Refseq NM_014360
Protein Refseq NP_055175
MIM 603245
UniProt ID O15522

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKX2-8 Products

Required fields are marked with *

My Review for All NKX2-8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon