Recombinant Human NKX3-1 Protein, GST-tagged
Cat.No. : | NKX3-1-5903H |
Product Overview : | Human NKX3-1 full-length ORF ( ABZ92171.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-234 a.a. |
Description : | The homeodomain-containing transcription factor NKX3-1 is a putative prostate tumor suppressor that is expressed in a largely prostate-specific and androgen-regulated manner. Loss of NKX3-1 protein expression is a common finding in human prostate carcinomas and prostatic intraepithelial neoplasia.[supplied by OMIM |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKX3-1 NK3 homeobox 1 [ Homo sapiens ] |
Official Symbol | NKX3-1 |
Synonyms | NKX3-1; NK3 homeobox 1; NK homeobox (Drosophila), family 3, A , NK3 transcription factor related, locus 1 (Drosophila) , NKX3A; homeobox protein Nkx-3.1; BAPX2; NKX3.1; NK homeobox, family 3, A; homeobox protein NK-3 homolog A; NK3 transcription factor homolog A; NK3 transcription factor related, locus 1; NKX3; NKX3A; |
Gene ID | 4824 |
mRNA Refseq | NM_001256339 |
Protein Refseq | NP_001243268 |
MIM | 602041 |
UniProt ID | Q99801 |
◆ Recombinant Proteins | ||
NKX3-1-28096TH | Recombinant Human NKX3-1 | +Inquiry |
NKX3-1-5903H | Recombinant Human NKX3-1 Protein, GST-tagged | +Inquiry |
NKX3-1-039H | Recombinant Human NK3 homeobox 1 Protein, His&Flag&StrepII tagged | +Inquiry |
NKX3-1-6706HF | Recombinant Full Length Human NKX3-1 Protein, GST-tagged | +Inquiry |
Nkx3-1-4427M | Recombinant Mouse Nkx3-1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NKX3-1 Products
Required fields are marked with *
My Review for All NKX3-1 Products
Required fields are marked with *
0
Inquiry Basket