Recombinant Human NKX6-2 protein, His-tagged
| Cat.No. : | NKX6-2-2851H |
| Product Overview : | Recombinant Human NKX6-2 protein(1-102 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-102 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGISDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NKX6-2 NK6 homeobox 2 [ Homo sapiens ] |
| Official Symbol | NKX6-2 |
| Synonyms | NKX6-2; NK6 homeobox 2; NK6 transcription factor related, locus 2 (Drosophila); homeobox protein Nkx-6.2; GTX; NKX6.1; NKX6B; homeobox 6B; NK homeobox family 6, B; homeobox protein NK-6 homolog B; NK6 transcription factor related, locus 2; glial and testis-specific homeobox protein; NKX6.2; MGC126684; |
| Gene ID | 84504 |
| mRNA Refseq | NM_177400 |
| Protein Refseq | NP_796374 |
| MIM | 605955 |
| UniProt ID | Q9C056 |
| ◆ Recombinant Proteins | ||
| NKX6-2-4382C | Recombinant Chicken NKX6-2 | +Inquiry |
| NKX6-2-2858R | Recombinant Rhesus Macaque NKX6-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NKX6-2-3632H | Recombinant Human NKX6-2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NKX6-2-4929H | Recombinant Human NKX6-2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NKX6-2-3039R | Recombinant Rhesus monkey NKX6-2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKX6-2 Products
Required fields are marked with *
My Review for All NKX6-2 Products
Required fields are marked with *
