Recombinant Human NLRP2 protein, His-tagged
Cat.No. : | NLRP2-3681H |
Product Overview : | Recombinant Human NLRP2 protein(1-350 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-350 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NLRP2 NLR family, pyrin domain containing 2 [ Homo sapiens ] |
Official Symbol | NLRP2 |
Synonyms | NLRP2; NLR family, pyrin domain containing 2; NACHT, leucine rich repeat and PYD containing 2 , NALP2; NACHT, LRR and PYD domains-containing protein 2; CLR19.9; FLJ20510; NBS1; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 2; PAN1; PYPAF2; nucleotide-binding site protein 1; PYRIN-containing APAF1-like protein 2; NACHT, LRR and PYD containing protein 2; NACHT, leucine rich repeat and PYD containing 2; PYRIN domain and NACHT domain-containing protein 1; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 2; NALP2; |
Gene ID | 55655 |
mRNA Refseq | NM_001174081 |
Protein Refseq | NP_001167552 |
MIM | 609364 |
UniProt ID | Q9NX02 |
◆ Recombinant Proteins | ||
NLRP2-36H | Recombinant Human NLRP2 Protein, MYC/DDK-tagged | +Inquiry |
NLRP2-5921H | Recombinant Human NLRP2 Protein, GST-tagged | +Inquiry |
NLRP2-179H | Recombinant Human NLRP2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NLRP2-3046R | Recombinant Rhesus monkey NLRP2 Protein, His-tagged | +Inquiry |
NLRP2-6755HF | Recombinant Full Length Human NLRP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP2-3800HCL | Recombinant Human NLRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLRP2 Products
Required fields are marked with *
My Review for All NLRP2 Products
Required fields are marked with *
0
Inquiry Basket