Recombinant Human NLRP2 protein, His-tagged

• Cat.No.: NLRP2-3681H
• Product Overview: Recombinant Human NLRP2 protein(1-350 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-350 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: NLRP2 NLR family, pyrin domain containing 2 [ Homo sapiens ]
• Official Symbol: NLRP2
• Synonyms: NLRP2; NLR family, pyrin domain containing 2; NACHT, leucine rich repeat and PYD containing 2 , NALP2; NACHT, LRR and PYD domains-containing protein 2; CLR19.9; FLJ20510; NBS1; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 2; PAN1; PYPAF2; nucleotide-binding site protein 1; PYRIN-containing APAF1-like protein 2; NACHT, LRR and PYD containing protein 2; NACHT, leucine rich repeat and PYD containing 2; PYRIN domain and NACHT domain-containing protein 1; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 2; NALP2
• Gene ID: 55655
• mRNA Refseq: NM_001174081
• Protein Refseq: NP_001167552
• MIM: 609364
• UniProt ID: Q9NX02