Recombinant Human NLRP2 protein, His-tagged

Cat.No. : NLRP2-3681H
Product Overview : Recombinant Human NLRP2 protein(1-350 aa), fused to His tag, was expressed in E. coli.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NLRP2 NLR family, pyrin domain containing 2 [ Homo sapiens ]
Official Symbol NLRP2
Synonyms NLRP2; NLR family, pyrin domain containing 2; NACHT, leucine rich repeat and PYD containing 2 , NALP2; NACHT, LRR and PYD domains-containing protein 2; CLR19.9; FLJ20510; NBS1; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 2; PAN1; PYPAF2; nucleotide-binding site protein 1; PYRIN-containing APAF1-like protein 2; NACHT, LRR and PYD containing protein 2; NACHT, leucine rich repeat and PYD containing 2; PYRIN domain and NACHT domain-containing protein 1; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 2; NALP2;
Gene ID 55655
mRNA Refseq NM_001174081
Protein Refseq NP_001167552
MIM 609364
UniProt ID Q9NX02

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLRP2 Products

Required fields are marked with *

My Review for All NLRP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon