Recombinant Human NME3, His-tagged
| Cat.No. : | NME3-28749TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 22-169 of Human NME3 with an N terminal His tag; 169 amino acids with tag, MWt 19.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 148 amino acids |
| Description : | Nucleoside diphosphate kinase 3 is an enzyme that in humans is encoded by the NME3 gene. |
| Conjugation : | HIS |
| Molecular Weight : | 19.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE |
| Gene Name | NME3 non-metastatic cells 3, protein expressed in [ Homo sapiens ] |
| Official Symbol | NME3 |
| Synonyms | NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23; |
| Gene ID | 4832 |
| mRNA Refseq | NM_002513 |
| Protein Refseq | NP_002504 |
| MIM | 601817 |
| Uniprot ID | Q13232 |
| Chromosome Location | 16q13.3 |
| Pathway | Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem; |
| Function | ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| NME3-28749TH | Recombinant Human NME3, His-tagged | +Inquiry |
| NME3-10740M | Recombinant Mouse NME3 Protein | +Inquiry |
| NME3-1312H | Recombinant Human NME3 protein, GST-tagged | +Inquiry |
| NME3-5442C | Recombinant Chicken NME3 | +Inquiry |
| NME3-5928H | Recombinant Human NME3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NME3-1200HCL | Recombinant Human NME3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME3 Products
Required fields are marked with *
My Review for All NME3 Products
Required fields are marked with *



