Recombinant Human NME3, His-tagged

Cat.No. : NME3-28749TH
Product Overview : Recombinant fragment corresponding to amino acids 22-169 of Human NME3 with an N terminal His tag; 169 amino acids with tag, MWt 19.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 148 amino acids
Description : Nucleoside diphosphate kinase 3 is an enzyme that in humans is encoded by the NME3 gene.
Conjugation : HIS
Molecular Weight : 19.100kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 50% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Gene Name NME3 non-metastatic cells 3, protein expressed in [ Homo sapiens ]
Official Symbol NME3
Synonyms NME3; non-metastatic cells 3, protein expressed in; nucleoside diphosphate kinase 3; DR nm23;
Gene ID 4832
mRNA Refseq NM_002513
Protein Refseq NP_002504
MIM 601817
Uniprot ID Q13232
Chromosome Location 16q13.3
Pathway Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem;
Function ATP binding; kinase activity; metal ion binding; nucleoside diphosphate kinase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NME3 Products

Required fields are marked with *

My Review for All NME3 Products

Required fields are marked with *

0
cart-icon
0
compare icon