Recombinant Human NME9 protein, GST-tagged

• Cat.No.: NME9-6755H
• Product Overview: Recombinant Human NME9 protein(1-151 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-151 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCEPTFLFYAIKDEALSDEDECVSHGKNNGEDEDMVSSERTCTLAIIKPDAVAHGKTDEIIMKIQEAGFEILTNEERTMTEAEVRLFYQHKAGE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: NME9 NME family member 9 [ Homo sapiens ]
• Official Symbol: NME9
• Synonyms: NME9; NME family member 9; NME gene family member 9 , thioredoxin domain containing 6 , TXNDC6; thioredoxin domain-containing protein 6; NM23 H9; TXL 2; thioredoxin-like 2; NME gene family member 9; thioredoxin-like protein 2; thioredoxin domain containing 6; TXL2; TXL-2; TXNDC6; NM23-H9; MGC129586
• Gene ID: 347736
• mRNA Refseq: NM_178130
• Protein Refseq: NP_835231
• UniProt ID: Q86XW9