Recombinant Human NNAT Protein, GST-tagged

Cat.No. : NNAT-5954H
Product Overview : Human NNAT full-length ORF ( AAH01768, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele, while BLCAP is not imprinted. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 34.65 kDa
AA Sequence : MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NNAT neuronatin [ Homo sapiens ]
Official Symbol NNAT
Synonyms NNAT; neuronatin; Peg5; MGC1439;
Gene ID 4826
mRNA Refseq NM_005386
Protein Refseq NP_005377
MIM 603106
UniProt ID Q16517

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NNAT Products

Required fields are marked with *

My Review for All NNAT Products

Required fields are marked with *

0
cart-icon