Recombinant Human NODAL protein, His-tagged
Cat.No. : | NODAL-2913H |
Product Overview : | Recombinant Human NODAL protein(40-338 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 40-338 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | PLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKRPGALEKQMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NODAL nodal homolog (mouse) [ Homo sapiens ] |
Official Symbol | NODAL |
Synonyms | NODAL; nodal homolog (mouse); nodal, mouse, homolog; nodal homolog; HTX5; MGC138230; |
Gene ID | 4838 |
mRNA Refseq | NM_018055 |
Protein Refseq | NP_060525 |
MIM | 601265 |
UniProt ID | Q96S42 |
◆ Recombinant Proteins | ||
NODAL-3648H | Recombinant Human NODAL Protein, His (Fc)-Avi-tagged | +Inquiry |
NODAL-30448TH | Recombinant Human NODAL | +Inquiry |
NODAL-29M | Recombinant Mouse NODAL Protein, His-tagged | +Inquiry |
NODAL-5964H | Recombinant Human NODAL Protein, GST-tagged | +Inquiry |
NODAL-6680HF | Recombinant Full Length Human NODAL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NODAL-3771HCL | Recombinant Human NODAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NODAL Products
Required fields are marked with *
My Review for All NODAL Products
Required fields are marked with *