Recombinant Human NODAL protein, His-tagged
| Cat.No. : | NODAL-2913H |
| Product Overview : | Recombinant Human NODAL protein(40-338 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 40-338 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | PLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKRPGALEKQMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKD |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | NODAL nodal homolog (mouse) [ Homo sapiens ] |
| Official Symbol | NODAL |
| Synonyms | NODAL; nodal homolog (mouse); nodal, mouse, homolog; nodal homolog; HTX5; MGC138230; |
| Gene ID | 4838 |
| mRNA Refseq | NM_018055 |
| Protein Refseq | NP_060525 |
| MIM | 601265 |
| UniProt ID | Q96S42 |
| ◆ Recombinant Proteins | ||
| NODAL-5964H | Recombinant Human NODAL Protein, GST-tagged | +Inquiry |
| NODAL-3648H | Recombinant Human NODAL Protein, His (Fc)-Avi-tagged | +Inquiry |
| NODAL-235H | Active Recombinant Human NODAL Protein (His238-Leu347), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| NODAL-30H | Recombinant Human Nodal | +Inquiry |
| NODAL-28M | Recombinant Mouse Nodal | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NODAL-3771HCL | Recombinant Human NODAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NODAL Products
Required fields are marked with *
My Review for All NODAL Products
Required fields are marked with *



