Recombinant Human NODAL Protein, His-tagged

• Cat.No.: NODAL-31H
• Product Overview: Recombinant Human Nodal, C-His-tagged,was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: His238-Leu347aa
• Tag: C-His
• Molecular Mass: 14 kDa
• AA Sequence: MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCLHHHHHHHH
• Purity: >90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.21mg/ml by A280
• Storage Buffer: Sterile PBS, pH 7.4, 0.05% SKL, 1mM DTT

Gene Information

• Gene Name: NODAL nodal growth differentiation factor [ Homo sapiens (human) ]
• Official Symbol: NODAL
• Synonyms: NODAL
• Gene ID: 4838
• UniProt ID: Q96S42