Recombinant Human NODAL Protein, His-tagged
| Cat.No. : | NODAL-31H |
| Product Overview : | Recombinant Human Nodal, C-His-tagged,was expressed in E. coli. |
| Availability | January 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | His238-Leu347aa |
| Tag : | C-His |
| Molecular Mass : | 14 kDa |
| AA Sequence : | MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCLHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.21mg/ml by A280 |
| Storage Buffer : | Sterile PBS, pH 7.4, 0.05% SKL, 1mM DTT |
| Gene Name | NODAL nodal growth differentiation factor [ Homo sapiens (human) ] |
| Official Symbol | NODAL |
| Synonyms | NODAL |
| Gene ID | 4838 |
| UniProt ID | Q96S42 |
| ◆ Recombinant Proteins | ||
| NODAL-28M | Recombinant Mouse Nodal | +Inquiry |
| NODAL-2494H | Recombinant Human NODAL Protein, His-tagged | +Inquiry |
| NODAL-30448TH | Recombinant Human NODAL | +Inquiry |
| NODAL-29M | Recombinant Mouse NODAL Protein, His-tagged | +Inquiry |
| NODAL-6680HF | Recombinant Full Length Human NODAL Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NODAL-3771HCL | Recombinant Human NODAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NODAL Products
Required fields are marked with *
My Review for All NODAL Products
Required fields are marked with *
