Recombinant Human NODAL Protein, His-tagged
Cat.No. : | NODAL-31H |
Product Overview : | Recombinant Human Nodal, C-His-tagged,was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | His238-Leu347aa |
Tag : | C-His |
Molecular Mass : | 14 kDa |
AA Sequence : | MHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCLHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.21mg/ml by A280 |
Storage Buffer : | Sterile PBS, pH 7.4, 0.05% SKL, 1mM DTT |
Gene Name | NODAL nodal growth differentiation factor [ Homo sapiens (human) ] |
Official Symbol | NODAL |
Synonyms | NODAL |
Gene ID | 4838 |
UniProt ID | Q96S42 |
◆ Recombinant Proteins | ||
NODAL-2913H | Recombinant Human NODAL protein, His-tagged | +Inquiry |
NODAL-6680HF | Recombinant Full Length Human NODAL Protein, GST-tagged | +Inquiry |
Nodal-1833M | Recombinant Mouse Nodal Protein, His-tagged | +Inquiry |
NODAL-28M | Recombinant Mouse Nodal | +Inquiry |
NODAL-2494H | Recombinant Human NODAL Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NODAL-3771HCL | Recombinant Human NODAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NODAL Products
Required fields are marked with *
My Review for All NODAL Products
Required fields are marked with *
0
Inquiry Basket