Recombinant Human NOG protein, His-tagged
Cat.No. : | NOG-7854H |
Product Overview : | Recombinant Human NOG protein(28-145 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-145 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL |
Gene Name | NOG noggin [ Homo sapiens ] |
Official Symbol | NOG |
Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
Gene ID | 9241 |
mRNA Refseq | NM_005450 |
Protein Refseq | NP_005441 |
MIM | 602991 |
UniProt ID | Q13253 |
◆ Recombinant Proteins | ||
Nog-019N | Active Recombinant Mouse Nog Protein (206 aa) | +Inquiry |
NOG-6343H | Recombinant Human NOG protein, GMP Grade, Animal-Free, For Organoid Culture | +Inquiry |
NOG-7854H | Recombinant Human NOG protein, His-tagged | +Inquiry |
NOG-293H | Recombinant Human NOG protein | +Inquiry |
NOG-321H | Recombinant Human NOG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *