Recombinant Human NOG protein, His-tagged
| Cat.No. : | NOG-7854H |
| Product Overview : | Recombinant Human NOG protein(28-145 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-145 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKL |
| Gene Name | NOG noggin [ Homo sapiens ] |
| Official Symbol | NOG |
| Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
| Gene ID | 9241 |
| mRNA Refseq | NM_005450 |
| Protein Refseq | NP_005441 |
| MIM | 602991 |
| UniProt ID | Q13253 |
| ◆ Recombinant Proteins | ||
| NOG-30336TH | Recombinant Human NOG | +Inquiry |
| NOG-1323H | Recombinant Human NOG, His-tagged | +Inquiry |
| Nog-6342M | Recombinant Mouse Nog protein, His-tagged, For Organoid Culture | +Inquiry |
| NOG-126H | Recombinant Human NOG Protein, His (Fc)-Avi-tagged | +Inquiry |
| NOG-1993H | Recombinant Human NOG protein, His-tagged, Animal-Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
