Recombinant Human NOP10 Protein, GST-tagged
Cat.No. : | NOP10-5981H |
Product Overview : | Human NOLA3 partial ORF ( NP_061118.1, 1 a.a. - 64 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA2 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nop10p. [provided by RefSeq |
Molecular Mass : | 32.78 kDa |
AA Sequence : | MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOP10 NOP10 ribonucleoprotein [ Homo sapiens (human) ] |
Official Symbol | NOP10 |
Synonyms | NOP10; DKCB1; NOLA3; NOP10P; NOP10 ribonucleoprotein; H/ACA ribonucleoprotein complex subunit 3; nucleolar protein 10; snoRNP protein NOP10; homolog of yeast Nop10p; NOP10 ribonucleoprotein homolog; nucleolar protein family A member 3; nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs) |
Gene ID | 55505 |
mRNA Refseq | NM_018648 |
Protein Refseq | NP_061118 |
MIM | 606471 |
UniProt ID | Q9NPE3 |
◆ Recombinant Proteins | ||
NOP10-5981H | Recombinant Human NOP10 Protein, GST-tagged | +Inquiry |
NOP10-794H | Recombinant Human NOP10 | +Inquiry |
NOP10-1155Z | Recombinant Zebrafish NOP10 | +Inquiry |
NOP10-3651H | Recombinant Human NOP10 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOP10-1158H | Recombinant Human NOP10 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOP10 Products
Required fields are marked with *
My Review for All NOP10 Products
Required fields are marked with *
0
Inquiry Basket