Recombinant Human NOS2 protein(1-200aa), His-tagged
Cat.No. : | NOS2-5432H |
Product Overview : | Recombinant Human NOS2 protein(P35228)(1-200aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-200aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC |
Gene Name | NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ] |
Official Symbol | NOS2 |
Synonyms | NOS2; nitric oxide synthase 2, inducible; nitric oxide synthase 2A (inducible, hepatocytes) , NOS2A; nitric oxide synthase, inducible; HEP NOS; iNOS; NOS; NOS type II; NOS, type II; inducible NOS; hepatocyte NOS; inducible NO synthase; nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2; nitric oxide synthase 2A (inducible, hepatocytes); INOS; NOS2A; HEP-NOS; |
Gene ID | 4843 |
mRNA Refseq | NM_000625 |
Protein Refseq | NP_000616 |
MIM | 163730 |
UniProt ID | P35228 |
◆ Recombinant Proteins | ||
Nos2-106M | Recombinant Mouse Nos2 Protein | +Inquiry |
NOS2-3683R | Recombinant Rat NOS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nos2-7800R | Recombinant Rat Nos2 protein, His-tagged | +Inquiry |
NOS2-2768H | Recombinant Human NOS2 protein, His-tagged | +Inquiry |
NOS2-5432H | Recombinant Human NOS2 protein(1-200aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS2-3759HCL | Recombinant Human NOS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOS2 Products
Required fields are marked with *
My Review for All NOS2 Products
Required fields are marked with *
0
Inquiry Basket