Recombinant Human NOS3
Cat.No. : | NOS3-28567TH |
Product Overview : | Recombinant fragment corresponding to amino acids 61-160 of Human eNOS with a proprietary tag; Predicted MWt 36.63 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. Variations in this gene are associated with susceptibility to coronary spasm. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Platelets, placenta, liver and kidney. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT |
Sequence Similarities : | Belongs to the NOS family.Contains 1 FAD-binding FR-type domain.Contains 1 flavodoxin-like domain. |
Gene Name | NOS3 nitric oxide synthase 3 (endothelial cell) [ Homo sapiens ] |
Official Symbol | NOS3 |
Synonyms | NOS3; nitric oxide synthase 3 (endothelial cell); nitric oxide synthase, endothelial; ECNOS; endothelial nitric oxide synthase; eNOS; |
Gene ID | 4846 |
mRNA Refseq | NM_000603 |
Protein Refseq | NP_000594 |
Uniprot ID | P29474 |
Chromosome Location | 7q36 |
Pathway | ACE Inhibitor Pathway, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Calcium signaling pathway, organism-specific biosystem; |
Function | FMN binding; NADP binding; actin monomer binding; arginine binding; cadmium ion binding; |
◆ Recombinant Proteins | ||
NOS3-7858P | Recombinant Pig NOS3 protein, His-tagged | +Inquiry |
NOS3-7854C | Recombinant Cattle NOS3 protein, His & T7-tagged | +Inquiry |
NOS3-66B | Recombinant bovine NOS3 Protein, His-tagged | +Inquiry |
NOS3-7856H | Recombinant Human NOS3 protein, His-tagged | +Inquiry |
NOS3-10787M | Recombinant Mouse NOS3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOS3-1206HCL | Recombinant Human NOS3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOS3 Products
Required fields are marked with *
My Review for All NOS3 Products
Required fields are marked with *