Recombinant Human NOTCH3
Cat.No. : | NOTCH3-29729TH |
Product Overview : | Recombinant fragment of Human NOTCH3 with N terminal proprietary tag, 37.73kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed in fetal and adult tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGP CAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCL SSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR |
Sequence Similarities : | Belongs to the NOTCH family.Contains 5 ANK repeats.Contains 34 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats. |
Gene Name | NOTCH3 notch 3 [ Homo sapiens ] |
Official Symbol | NOTCH3 |
Synonyms | NOTCH3; notch 3; CADASIL, Notch (Drosophila) homolog 3 , Notch homolog 3 (Drosophila); neurogenic locus notch homolog protein 3; CASIL; |
Gene ID | 4854 |
mRNA Refseq | NM_000435 |
Protein Refseq | NP_000426 |
MIM | 600276 |
Uniprot ID | Q9UM47 |
Chromosome Location | 19p13.2-p13.1 |
Pathway | A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem; Gene Expression, organism-specific biosystem; |
Function | calcium ion binding; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
Notch3-1839M | Recombinant Mouse Notch3 Protein, His&GST-tagged | +Inquiry |
NOTCH3-2543H | Recombinant Human Notch Homolog 3 (Drosophila), Fc Chimera | +Inquiry |
NOTCH3-047H | Recombinant Human NOTCH3 protein, hFc-tagged | +Inquiry |
Notch3-2544M | Recombinant Mouse Notch Gene Homolog 3 (Drosophila) , Fc Chimera | +Inquiry |
NOTCH3-4028R | Recombinant Rat NOTCH3 Protein | +Inquiry |
◆ Native Proteins | ||
NOTCH3-001H | Recombinant Human NOTCH3 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOTCH3 Products
Required fields are marked with *
My Review for All NOTCH3 Products
Required fields are marked with *