Recombinant Human NOTCH3

Cat.No. : NOTCH3-29729TH
Product Overview : Recombinant fragment of Human NOTCH3 with N terminal proprietary tag, 37.73kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Ubiquitously expressed in fetal and adult tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGP CAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCL SSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Sequence Similarities : Belongs to the NOTCH family.Contains 5 ANK repeats.Contains 34 EGF-like domains.Contains 3 LNR (Lin/Notch) repeats.
Gene Name NOTCH3 notch 3 [ Homo sapiens ]
Official Symbol NOTCH3
Synonyms NOTCH3; notch 3; CADASIL, Notch (Drosophila) homolog 3 , Notch homolog 3 (Drosophila); neurogenic locus notch homolog protein 3; CASIL;
Gene ID 4854
mRNA Refseq NM_000435
Protein Refseq NP_000426
MIM 600276
Uniprot ID Q9UM47
Chromosome Location 19p13.2-p13.1
Pathway A third proteolytic cleavage releases NICD, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Dorso-ventral axis formation, organism-specific biosystem; Dorso-ventral axis formation, conserved biosystem; Gene Expression, organism-specific biosystem;
Function calcium ion binding; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOTCH3 Products

Required fields are marked with *

My Review for All NOTCH3 Products

Required fields are marked with *

0
cart-icon