Recombinant Human NOTCH3 Protein, GST-tagged

Cat.No. : NOTCH3-5999H
Product Overview : Human NOTCH3 partial ORF ( NP_000426, 47 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL). [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : SPCANGGRCTQLPSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NOTCH3 notch 3 [ Homo sapiens ]
Official Symbol NOTCH3
Synonyms NOTCH3; notch 3; CADASIL, Notch (Drosophila) homolog 3 , Notch homolog 3 (Drosophila); neurogenic locus notch homolog protein 3; CASIL; Notch homolog 3; CADASIL;
Gene ID 4854
mRNA Refseq NM_000435
Protein Refseq NP_000426
MIM 600276
UniProt ID Q9UM47

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOTCH3 Products

Required fields are marked with *

My Review for All NOTCH3 Products

Required fields are marked with *

0
cart-icon