Recombinant Human NOTUM Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NOTUM-1624H |
Product Overview : | NOTUM MS Standard C13 and N15-labeled recombinant protein (NP_848588) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NOTUM (Notum, Palmitoleoyl-Protein Carboxylesterase) is a Protein Coding gene. Diseases associated with NOTUM include Scalp-Ear-Nipple Syndrome and Suppurative Periapical Periodontitis. Among its related pathways are Signaling by GPCR and Regulation of activated PAK-2p34 by proteasome mediated degradation. Gene Ontology (GO) annotations related to this gene include hydrolase activity and palmitoleyl hydrolase activity. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRWLLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFIPYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLLNVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNGVVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGLRLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHDSHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQPQGLEPSELLGMLSNGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NOTUM notum, palmitoleoyl-protein carboxylesterase [ Homo sapiens (human) ] |
Official Symbol | NOTUM |
Synonyms | NOTUM; notum pectinacetylesterase homolog (Drosophila); protein notum homolog; |
Gene ID | 147111 |
mRNA Refseq | NM_178493 |
Protein Refseq | NP_848588 |
MIM | 609847 |
UniProt ID | Q6P988 |
◆ Recombinant Proteins | ||
NOTUM-6142M | Recombinant Mouse NOTUM Protein, His (Fc)-Avi-tagged | +Inquiry |
NOTUM-25M | Active Recombinant Mouse Notum Protein, His-tagged | +Inquiry |
NOTUM-1335H | Recombinant Human NOTUM protein, MYC/DDK-tagged | +Inquiry |
Notum-1434M | Recombinant Mouse Notum Protein, Myc/DDK-tagged | +Inquiry |
NOTUM-1624H | Recombinant Human NOTUM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOTUM-3754HCL | Recombinant Human NOTUM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOTUM Products
Required fields are marked with *
My Review for All NOTUM Products
Required fields are marked with *
0
Inquiry Basket