Recombinant Human NOV, His-tagged

Cat.No. : NOV-27805TH
Product Overview : Recombinant fragment: KGKKCLRTKK SLKAIHLQFK NCTSLHTYKP RFCGVCSDGR CCTPHNTKTI QAEFQCSPGQ IVKKPVMVIG TCTCHTNCPK NNEAFLQELE LKTTRGKM, corresponding to amino acids 260-357 of Human CCN3, fused to His tag, 18kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 260-357 a.a.
Description : The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
Conjugation : HIS
Tissue specificity : Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 1X PBS
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Sequence Similarities : Belongs to the CCN family.Contains 1 CTCK (C-terminal cystine knot-like) domain.Contains 1 IGFBP N-terminal domain.Contains 1 TSP type-1 domain.Contains 1 VWFC domain.
Gene Name NOV nephroblastoma overexpressed gene [ Homo sapiens ]
Official Symbol NOV
Synonyms NOV; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9;
Gene ID 4856
mRNA Refseq NM_002514
Protein Refseq NP_002505
MIM 164958
Uniprot ID P48745
Chromosome Location 8q24.12
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem;
Function growth factor activity; insulin-like growth factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOV Products

Required fields are marked with *

My Review for All NOV Products

Required fields are marked with *

0
cart-icon
0
compare icon