Recombinant Human NOV, His-tagged

• Cat.No.: NOV-27805TH
• Product Overview: Recombinant fragment: KGKKCLRTKK SLKAIHLQFK NCTSLHTYKP RFCGVCSDGR CCTPHNTKTI QAEFQCSPGQ IVKKPVMVIG TCTCHTNCPK NNEAFLQELE LKTTRGKM, corresponding to amino acids 260-357 of Human CCN3, fused to His tag, 18kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 260-357 a.a.
• Description: The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
• Conjugation: HIS
• Tissue specificity: Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 1X PBS
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
• Sequence Similarities: Belongs to the CCN family.Contains 1 CTCK (C-terminal cystine knot-like) domain.Contains 1 IGFBP N-terminal domain.Contains 1 TSP type-1 domain.Contains 1 VWFC domain.

Gene Information

• Gene Name: NOV nephroblastoma overexpressed gene [ Homo sapiens ]
• Official Symbol: NOV
• Synonyms: NOV; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9
• Gene ID: 4856
• mRNA Refseq: NM_002514
• Protein Refseq: NP_002505
• MIM: 164958
• Uniprot ID: P48745
• Chromosome Location: 8q24.12
• Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem
• Function: growth factor activity; insulin-like growth factor binding