Recombinant Human NOV, His-tagged
Cat.No. : | NOV-27805TH |
Product Overview : | Recombinant fragment: KGKKCLRTKK SLKAIHLQFK NCTSLHTYKP RFCGVCSDGR CCTPHNTKTI QAEFQCSPGQ IVKKPVMVIG TCTCHTNCPK NNEAFLQELE LKTTRGKM, corresponding to amino acids 260-357 of Human CCN3, fused to His tag, 18kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 260-357 a.a. |
Description : | The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development. |
Conjugation : | HIS |
Tissue specificity : | Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 1X PBS |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
Sequence Similarities : | Belongs to the CCN family.Contains 1 CTCK (C-terminal cystine knot-like) domain.Contains 1 IGFBP N-terminal domain.Contains 1 TSP type-1 domain.Contains 1 VWFC domain. |
Gene Name | NOV nephroblastoma overexpressed gene [ Homo sapiens ] |
Official Symbol | NOV |
Synonyms | NOV; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; |
Gene ID | 4856 |
mRNA Refseq | NM_002514 |
Protein Refseq | NP_002505 |
MIM | 164958 |
Uniprot ID | P48745 |
Chromosome Location | 8q24.12 |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; |
Function | growth factor activity; insulin-like growth factor binding; |
◆ Recombinant Proteins | ||
Nov-434M | Recombinant Mouse Nov Protein, His-tagged | +Inquiry |
NOV-3688R | Recombinant Rat NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
NOV-219C | Recombinant Canine NOV, His tagged | +Inquiry |
NOV-4029R | Recombinant Rat NOV Protein | +Inquiry |
NOV-10795M | Recombinant Mouse NOV Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOV-694HCL | Recombinant Human NOV cell lysate | +Inquiry |
NOV-897CCL | Recombinant Canine NOV cell lysate | +Inquiry |
NOV-001CCL | Recombinant Cynomolgus NOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOV Products
Required fields are marked with *
My Review for All NOV Products
Required fields are marked with *
0
Inquiry Basket