Recombinant Human NOV protein, T7/His-tagged
Cat.No. : | NOV-80H |
Product Overview : | Recombinant human NOV cDNA (32 - 357aa, derived from BC015028) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 32-357 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFTQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSD LEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPE PNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTR VTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCT PHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro NOV mediated various type of cells differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for NOV protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | NOV nephroblastoma overexpressed [ Homo sapiens ] |
Official Symbol | NOV |
Synonyms | NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP |
Gene ID | 4856 |
mRNA Refseq | NM_002514 |
Protein Refseq | NP_002505 |
MIM | 164958 |
UniProt ID | P48745 |
Chromosome Location | 8q24.12 |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; |
Function | growth factor activity; insulin-like growth factor binding; |
◆ Recombinant Proteins | ||
NOV-80H | Recombinant Human NOV protein, T7/His-tagged | +Inquiry |
NOV-4466H | Recombinant Human NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
NOV-2892R | Recombinant Rhesus Macaque NOV Protein, His (Fc)-Avi-tagged | +Inquiry |
NOV-6719HF | Recombinant Full Length Human NOV Protein, GST-tagged | +Inquiry |
Nov-435R | Recombinant Rat Nov Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOV-001CCL | Recombinant Cynomolgus NOV cell lysate | +Inquiry |
NOV-897CCL | Recombinant Canine NOV cell lysate | +Inquiry |
NOV-694HCL | Recombinant Human NOV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOV Products
Required fields are marked with *
My Review for All NOV Products
Required fields are marked with *