Recombinant Human NOV protein, T7/His-tagged

Cat.No. : NOV-80H
Product Overview : Recombinant human NOV cDNA (32 - 357aa, derived from BC015028) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 32-357 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFTQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSD LEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPE PNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTR VTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCT PHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro NOV mediated various type of cells differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for NOV protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name NOV nephroblastoma overexpressed [ Homo sapiens ]
Official Symbol NOV
Synonyms NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP
Gene ID 4856
mRNA Refseq NM_002514
Protein Refseq NP_002505
MIM 164958
UniProt ID P48745
Chromosome Location 8q24.12
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem;
Function growth factor activity; insulin-like growth factor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NOV Products

Required fields are marked with *

My Review for All NOV Products

Required fields are marked with *

0
cart-icon
0
compare icon