"NOV" Related Products

Expand
Expand
Expand

Recombinant Human NOV protein, T7/His-tagged

Cat.No.: NOV-80H
Product Overview: Recombinant human NOV cDNA (32 - 357aa, derived from BC015028) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFTQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSD LEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPE PNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTR VTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCT PHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro NOV mediated various type of cells differentiation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for NOV protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: NOV nephroblastoma overexpressed [ Homo sapiens ]
Official Symbol: NOV
Synonyms: NOV; nephroblastoma overexpressed; nephroblastoma overexpressed gene; protein NOV homolog; CCN3; IGFBP9; CCN family member 3; IGF-binding protein 9; insulin-like growth factor-binding protein 9; nephroblastoma-overexpressed gene protein homolog; NOVh; IBP
Gene ID: 4856
mRNA Refseq: NM_002514
Protein Refseq: NP_002505
MIM: 164958
UniProt ID: P48745
Chromosome Location: 8q24.12
Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem;
Function: growth factor activity; insulin-like growth factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.