Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NPDC1-935H |
| Product Overview : | NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | NPDC1 (Neural Proliferation, Differentiation And Control 1) is a Protein Coding gene. |
| Molecular Mass : | 34.5 kDa |
| AA Sequence : | MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NPDC1 neural proliferation, differentiation and control 1 [ Homo sapiens (human) ] |
| Official Symbol | NPDC1 |
| Synonyms | NPDC1; neural proliferation, differentiation and control 1; CAB; CAB-; CAB1; CAB-1; NPDC-1; neural proliferation differentiation and control protein 1 |
| Gene ID | 56654 |
| mRNA Refseq | NM_015392 |
| Protein Refseq | NP_056207 |
| MIM | 605798 |
| UniProt ID | Q9NQX5 |
| ◆ Recombinant Proteins | ||
| NPDC1-935H | Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NPDC1-5025H | Recombinant Human NPDC1 Protein (Gly35-Asp181), C-His tagged | +Inquiry |
| NPDC1-1339H | Recombinant Human NPDC1, GST-tagged | +Inquiry |
| NPDC1-049H | Recombinant Human NPDC1 Protein, HIS-tagged | +Inquiry |
| NPDC1-1271H | Recombinant Human NPDC1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPDC1 Products
Required fields are marked with *
My Review for All NPDC1 Products
Required fields are marked with *



