Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NPDC1-935H
Product Overview : NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : NPDC1 (Neural Proliferation, Differentiation And Control 1) is a Protein Coding gene.
Molecular Mass : 34.5 kDa
AA Sequence : MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NPDC1 neural proliferation, differentiation and control 1 [ Homo sapiens (human) ]
Official Symbol NPDC1
Synonyms NPDC1; neural proliferation, differentiation and control 1; CAB; CAB-; CAB1; CAB-1; NPDC-1; neural proliferation differentiation and control protein 1
Gene ID 56654
mRNA Refseq NM_015392
Protein Refseq NP_056207
MIM 605798
UniProt ID Q9NQX5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPDC1 Products

Required fields are marked with *

My Review for All NPDC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon