Recombinant Human NPDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NPDC1-935H |
Product Overview : | NPDC1 MS Standard C13 and N15-labeled recombinant protein (NP_056207) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NPDC1 (Neural Proliferation, Differentiation And Control 1) is a Protein Coding gene. |
Molecular Mass : | 34.5 kDa |
AA Sequence : | MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NPDC1 neural proliferation, differentiation and control 1 [ Homo sapiens (human) ] |
Official Symbol | NPDC1 |
Synonyms | NPDC1; neural proliferation, differentiation and control 1; CAB; CAB-; CAB1; CAB-1; NPDC-1; neural proliferation differentiation and control protein 1 |
Gene ID | 56654 |
mRNA Refseq | NM_015392 |
Protein Refseq | NP_056207 |
MIM | 605798 |
UniProt ID | Q9NQX5 |
◆ Recombinant Proteins | ||
Npdc1-4469M | Recombinant Mouse Npdc1 Protein, Myc/DDK-tagged | +Inquiry |
NPDC1-6154M | Recombinant Mouse NPDC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPDC1-10813M | Recombinant Mouse NPDC1 Protein | +Inquiry |
NPDC1-352H | Recombinant Human NPDC1 protein, His-tagged | +Inquiry |
NPDC1-6021H | Recombinant Human NPDC1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPDC1-752HCL | Recombinant Human NPDC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPDC1 Products
Required fields are marked with *
My Review for All NPDC1 Products
Required fields are marked with *
0
Inquiry Basket