Recombinant Human NPHS1 protein(1131-1220 aa), C-His-tagged
Cat.No. : | NPHS1-2474H |
Product Overview : | Recombinant Human NPHS1 protein(O60500)(1131-1220 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1131-1220 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | STTEAEPYYRSLRDFSPQLPPTQEEVSYSRGFTGEDEDMAFPGHLYDEVERTYPPSGAWGPLYDEVQMGPWDLHWPEDTYQDPRGIYDQV |
Gene Name | NPHS1 nephrosis 1, congenital, Finnish type (nephrin) [ Homo sapiens ] |
Official Symbol | NPHS1 |
Synonyms | NPHS1; nephrosis 1, congenital, Finnish type (nephrin); nephrin; CNF; NPHN; renal glomerulus-specific cell adhesion receptor; |
Gene ID | 4868 |
mRNA Refseq | NM_004646 |
Protein Refseq | NP_004637 |
MIM | 602716 |
UniProt ID | O60500 |
◆ Recombinant Proteins | ||
NPHS1-5640H | Recombinant Human NPHS1 protein, His & T7-tagged | +Inquiry |
NPHS1-4726H | Recombinant Human NPHS1 Protein (Pro89-Trp374), N-His tagged | +Inquiry |
NPHS1-3815Z | Recombinant Zebrafish NPHS1 | +Inquiry |
NPHS1-10822M | Recombinant Mouse NPHS1 Protein | +Inquiry |
NPHS1-6031H | Recombinant Human NPHS1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPHS1 Products
Required fields are marked with *
My Review for All NPHS1 Products
Required fields are marked with *
0
Inquiry Basket