Recombinant Human NPM1 protein, His-tagged

• Cat.No.: NPM1-181H
• Product Overview: Recombinant Human NPM1 protein(P06748-1) (Glu 2-Leu 294) was expressed in E.coli with a polyhistide tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-294 aa
• Form: Supplied as sterile 30 mM Hepes, 2 mM EDTA, 0.001 % Tween, 15 % glycerol, pH 7.0.
• Molecular Mass: The recombinant human NPM1 consists of 304 amino acids and has a calculated molecular mass of 34 kDa.
• AASequence: MHHHHHHHHHHEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
• Endotoxin: < 1.0 EU per μg of the protein as determined by the LAL method.
• Purity: > 85 % as determined by SDS-PAGE
• Storage: Store it under sterile conditions at -20°C to -80°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.2-1.0 mg/mL.

Gene Information

• Gene Name: NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
• Official Symbol: NPM1
• Synonyms: NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254
• Gene ID: 4869
• mRNA Refseq: NM_001037738
• Protein Refseq: NP_001032827
• MIM: 164040
• UniProt ID: P06748