Recombinant Human NPM2 Protein, GST-tagged

Cat.No. : NPM2-6038H
Product Overview : Human NPM2 full-length ORF ( NP_877724.1, 1 a.a. - 214 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NPM2 (Nucleophosmin/Nucleoplasmin 2) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding and enzyme binding. An important paralog of this gene is NPM1.
Molecular Mass : 50.6 kDa
AA Sequence : MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPM2 nucleophosmin/nucleoplasmin 2 [ Homo sapiens ]
Official Symbol NPM2
Synonyms NPM2; nucleophosmin/nucleoplasmin 2; nucleoplasmin-2; MGC78655;
Gene ID 10361
mRNA Refseq NM_182795
Protein Refseq NP_877724
MIM 608073
UniProt ID Q86SE8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPM2 Products

Required fields are marked with *

My Review for All NPM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon