Recombinant Human NPPA protein, His-tagged
Cat.No. : | NPPA-3689H |
Product Overview : | Recombinant Human NPPA protein(26-153 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-153 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NPPA natriuretic peptide A [ Homo sapiens ] |
Official Symbol | NPPA |
Synonyms | NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A; atriopeptin; cardionatrin; prepronatriodilatin; natriuretic peptide precursor A; ANF; ANP; PND; ATFB6; CDD-ANF; |
Gene ID | 4878 |
mRNA Refseq | NM_006172 |
Protein Refseq | NP_006163 |
MIM | 108780 |
UniProt ID | P01160 |
◆ Recombinant Proteins | ||
NPPA-2689H | Recombinant Human NPPA protein, His & GST-tagged | +Inquiry |
NPPA-1252H | Recombinant Human NPPA protein, His-tagged | +Inquiry |
NPPA-1347H | Recombinant Human NPPA, GST-tagged | +Inquiry |
NPPA-4730H | Recombinant Human NPPA Protein (Ala25-Arg123), N-GST tagged | +Inquiry |
NPPA-35H | Recombinant Human NPPA protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPPA-3735HCL | Recombinant Human NPPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPPA Products
Required fields are marked with *
My Review for All NPPA Products
Required fields are marked with *