Recombinant Human NPR1
Cat.No. : | NPR1-28546TH |
Product Overview : | Recombinant fragment of Human Natriuretic Peptide Receptor A with a proprietary tag; predicted MWt 36.74 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 101 amino acids |
Description : | Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 |
Molecular Weight : | 36.740kDa inclusive of tags |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS |
Sequence Similarities : | Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.Contains 1 guanylate cyclase domain.Contains 1 protein kinase domain. |
Gene Name | NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ] |
Official Symbol | NPR1 |
Synonyms | NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A; |
Gene ID | 4881 |
mRNA Refseq | NM_000906 |
Protein Refseq | NP_000897 |
MIM | 108960 |
Uniprot ID | P16066 |
Chromosome Location | 1q21-q22 |
Pathway | Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem; |
Function | ATP binding; G-protein coupled peptide receptor activity; GTP binding; guanylate cyclase activity; hormone binding; |
◆ Recombinant Proteins | ||
NPR1-1299H | Recombinant Human NPR1 Protein, His-tagged | +Inquiry |
NPR1-6043H | Recombinant Human NPR1 Protein, GST-tagged | +Inquiry |
NPR1-1476H | Recombinant Human NPR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NPR1-3285H | Recombinant Human NPR1 protein, His-SUMO-tagged | +Inquiry |
NPR1-0539H | Active Recombinant Human NPR1 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPR1-3733HCL | Recombinant Human NPR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPR1 Products
Required fields are marked with *
My Review for All NPR1 Products
Required fields are marked with *