Recombinant Human NPR1
| Cat.No. : | NPR1-28546TH |
| Product Overview : | Recombinant fragment of Human Natriuretic Peptide Receptor A with a proprietary tag; predicted MWt 36.74 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 101 amino acids |
| Description : | Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 |
| Molecular Weight : | 36.740kDa inclusive of tags |
| Biological activity : | useful for Antibody Production and Protein Array |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS |
| Sequence Similarities : | Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.Contains 1 guanylate cyclase domain.Contains 1 protein kinase domain. |
| Gene Name | NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ] |
| Official Symbol | NPR1 |
| Synonyms | NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A; |
| Gene ID | 4881 |
| mRNA Refseq | NM_000906 |
| Protein Refseq | NP_000897 |
| MIM | 108960 |
| Uniprot ID | P16066 |
| Chromosome Location | 1q21-q22 |
| Pathway | Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem; |
| Function | ATP binding; G-protein coupled peptide receptor activity; GTP binding; guanylate cyclase activity; hormone binding; |
| ◆ Recombinant Proteins | ||
| NPR1-28546TH | Recombinant Human NPR1 | +Inquiry |
| NPR1-1476H | Recombinant Human NPR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Npr1-4476M | Recombinant Mouse Npr1 Protein, Myc/DDK-tagged | +Inquiry |
| NPR1-357HFL | Recombinant Full Length Human NPR1 Protein, C-Flag-tagged | +Inquiry |
| NPR1-3667H | Recombinant Human NPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPR1-3733HCL | Recombinant Human NPR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPR1 Products
Required fields are marked with *
My Review for All NPR1 Products
Required fields are marked with *



