Recombinant Human NPR1

• Cat.No.: NPR1-28546TH
• Product Overview: Recombinant fragment of Human Natriuretic Peptide Receptor A with a proprietary tag; predicted MWt 36.74 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 101 amino acids
• Description: Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994
• Molecular Weight: 36.740kDa inclusive of tags
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GVKDEYALTTRAGPSYAKLGDFVAALHRRLGWERQALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGRVIYICSS
• Sequence Similarities: Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.Contains 1 guanylate cyclase domain.Contains 1 protein kinase domain.

Gene Information

• Gene Name: NPR1 natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) [ Homo sapiens ]
• Official Symbol: NPR1
• Synonyms: NPR1; natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A); ANPRA, NPRA; atrial natriuretic peptide receptor 1; ANPa; GUCY2A
• Gene ID: 4881
• mRNA Refseq: NM_000906
• Protein Refseq: NP_000897
• MIM: 108960
• Uniprot ID: P16066
• Chromosome Location: 1q21-q22
• Pathway: Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Vascular smooth muscle contraction, organism-specific biosystem; Vascular smooth muscle contraction, conserved biosystem
• Function: ATP binding; G-protein coupled peptide receptor activity; GTP binding; guanylate cyclase activity; hormone binding