Recombinant Human NPR3 Protein, GST-tagged
Cat.No. : | NPR3-6046H |
Product Overview : | Human NPR3 partial ORF ( NP_000899, 42 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The family of natriuretic peptides (see MIM 108780) elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. These effects are mediated by specific binding of the peptides to cell surface receptors in the vasculature, kidney, adrenal, and brain.[supplied by OMIM |
Molecular Mass : | 36.63 kDa |
AA Sequence : | RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NPR3 natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) [ Homo sapiens ] |
Official Symbol | NPR3 |
Synonyms | NPR3; natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C); ANPRC, C5orf23, chromosome 5 open reading frame 23 , NPRC; atrial natriuretic peptide receptor 3; FLJ14054; GUCY2B; atrial natriuretic peptide receptor type C; atrial natriuretic peptide clearance receptor; NPRC; ANP-C; ANPRC; NPR-C; ANPR-C; C5orf23; MGC22189; |
Gene ID | 4883 |
mRNA Refseq | NM_000908 |
Protein Refseq | NP_000899 |
MIM | 108962 |
UniProt ID | P17342 |
◆ Recombinant Proteins | ||
NPR3-12H | Active Recombinant Human NPR3 Protein (Thr24-Glu481), C-Fc tagged | +Inquiry |
NPR3-27852TH | Recombinant Human NPR3 | +Inquiry |
NPR3-5487H | Recombinant Human NPR3 protein, His-Myc-tagged | +Inquiry |
RFL33334MF | Recombinant Full Length Mouse Atrial Natriuretic Peptide Receptor 3(Npr3) Protein, His-Tagged | +Inquiry |
NPR3-151H | Recombinant Human NPR3(Thr24-Glu481) Protein, C-Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPR3-3732HCL | Recombinant Human NPR3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPR3 Products
Required fields are marked with *
My Review for All NPR3 Products
Required fields are marked with *