Recombinant Human NPR3 Protein, GST-tagged

Cat.No. : NPR3-6046H
Product Overview : Human NPR3 partial ORF ( NP_000899, 42 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The family of natriuretic peptides (see MIM 108780) elicit a number of vascular, renal, and endocrine effects that are important in the maintenance of blood pressure and extracellular fluid volume. These effects are mediated by specific binding of the peptides to cell surface receptors in the vasculature, kidney, adrenal, and brain.[supplied by OMIM
Molecular Mass : 36.63 kDa
AA Sequence : RQEREALPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLILGPVCEYAA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NPR3 natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C) [ Homo sapiens ]
Official Symbol NPR3
Synonyms NPR3; natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C); ANPRC, C5orf23, chromosome 5 open reading frame 23 , NPRC; atrial natriuretic peptide receptor 3; FLJ14054; GUCY2B; atrial natriuretic peptide receptor type C; atrial natriuretic peptide clearance receptor; NPRC; ANP-C; ANPRC; NPR-C; ANPR-C; C5orf23; MGC22189;
Gene ID 4883
mRNA Refseq NM_000908
Protein Refseq NP_000899
MIM 108962
UniProt ID P17342

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPR3 Products

Required fields are marked with *

My Review for All NPR3 Products

Required fields are marked with *

0
cart-icon
0
compare icon