Recombinant Human NR2E3 protein, GST-tagged
| Cat.No. : | NR2E3-7844H |
| Product Overview : | Recombinant Human NR2E3 protein(1-322 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-322 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | NR2E3 nuclear receptor subfamily 2, group E, member 3 [ Homo sapiens ] |
| Official Symbol | NR2E3 |
| Synonyms | NR2E3; nuclear receptor subfamily 2, group E, member 3; photoreceptor-specific nuclear receptor; PNR; rd7; RP37; retina-specific nuclear receptor; photoreceptor cell-specific nuclear receptor variant 1; RNR; ESCS; MGC49976; |
| Gene ID | 10002 |
| mRNA Refseq | NM_014249 |
| Protein Refseq | NP_055064 |
| MIM | 604485 |
| UniProt ID | Q9Y5X4 |
| ◆ Recombinant Proteins | ||
| NR2E3-1583H | Recombinant Human NR2E3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NR2E3-7844H | Recombinant Human NR2E3 protein, GST-tagged | +Inquiry |
| Nr2e3-4490M | Recombinant Mouse Nr2e3 Protein, Myc/DDK-tagged | +Inquiry |
| NR2E3-6739HF | Recombinant Full Length Human NR2E3 Protein, GST-tagged | +Inquiry |
| NR2E3-1756Z | Recombinant Zebrafish NR2E3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NR2E3-3711HCL | Recombinant Human NR2E3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NR2E3 Products
Required fields are marked with *
My Review for All NR2E3 Products
Required fields are marked with *
