Recombinant Human NR4A1 Protein, GST-tagged

Cat.No. : NR4A1-6093H
Product Overview : Human NR4A1 full-length ORF ( AAH16147, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Molecular Mass : 91.52 kDa
AA Sequence : MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTRGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NR4A1 nuclear receptor subfamily 4, group A, member 1 [ Homo sapiens ]
Official Symbol NR4A1
Synonyms NR4A1; nuclear receptor subfamily 4, group A, member 1; GFRP1, HMR; nuclear receptor subfamily 4 group A member 1; N10; NAK 1; NGFIB; NUR77; TR3; ST-59; hormone receptor; TR3 orphan receptor; steroid receptor TR3; testicular receptor 3; early response protein NAK1; orphan nuclear receptor HMR; orphan nuclear receptor TR3; nuclear hormone receptor NUR/77; growth factor-inducible nuclear protein N10; nerve growth factor IB nuclear receptor variant 1; HMR; NP10; GFRP1; NAK-1; MGC9485;
Gene ID 3164
mRNA Refseq NM_001202233
Protein Refseq NP_001189162
MIM 139139
UniProt ID P22736

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NR4A1 Products

Required fields are marked with *

My Review for All NR4A1 Products

Required fields are marked with *

0
cart-icon