Recombinant Human NR4A2( 347S) Protein, His tagged

Cat.No. : NR4A2-01H
Product Overview : Recombinant Human NR4A2( 347S) Protein with His-tag was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
AA Sequence : MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPAKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Purity : > 85% by SDS-PAGE
Storage : Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.3 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens (human) ]
Official Symbol NR4A2
Synonyms NR4A2; nuclear receptor subfamily 4, group A, member 2; NURR1; nuclear receptor subfamily 4 group A member 2; HZF 3; NOT; RNR1; TINUR; nuclear receptor related 1; T-cell nuclear receptor NOT; orphan nuclear receptor NR4A2; orphan nuclear receptor NURR1; intermediate-early receptor protein; immediate-early response protein NOT; nur related protein-1, human homolog of; transcriptionally-inducible nuclear receptor; NGFI-B/nur77 beta-type transcription factor homolog; transcriptionally inducible nuclear receptor related 1; HZF-3;
Gene ID 4929
mRNA Refseq NM_006186
Protein Refseq NP_006177
MIM 601828
UniProt ID P43354

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NR4A2 Products

Required fields are marked with *

My Review for All NR4A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon