Recombinant Human NR4A2( 347S) Protein, His tagged
Cat.No. : | NR4A2-01H |
Product Overview : | Recombinant Human NR4A2( 347S) Protein with His-tag was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson disease, schizophernia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. |
AA Sequence : | MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPAKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF |
Purity : | > 85% by SDS-PAGE |
Storage : | Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.3 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens (human) ] |
Official Symbol | NR4A2 |
Synonyms | NR4A2; nuclear receptor subfamily 4, group A, member 2; NURR1; nuclear receptor subfamily 4 group A member 2; HZF 3; NOT; RNR1; TINUR; nuclear receptor related 1; T-cell nuclear receptor NOT; orphan nuclear receptor NR4A2; orphan nuclear receptor NURR1; intermediate-early receptor protein; immediate-early response protein NOT; nur related protein-1, human homolog of; transcriptionally-inducible nuclear receptor; NGFI-B/nur77 beta-type transcription factor homolog; transcriptionally inducible nuclear receptor related 1; HZF-3; |
Gene ID | 4929 |
mRNA Refseq | NM_006186 |
Protein Refseq | NP_006177 |
MIM | 601828 |
UniProt ID | P43354 |
◆ Recombinant Proteins | ||
NR4A2-371HFL | Recombinant Full Length Human NR4A2 Protein, C-Flag-tagged | +Inquiry |
NR4A2-6190M | Recombinant Mouse NR4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR4A2-4071R | Recombinant Rat NR4A2 Protein | +Inquiry |
NR4A2-01H | Recombinant Human NR4A2( 347S) Protein, His tagged | +Inquiry |
Nr4a2-4491M | Recombinant Mouse Nr4a2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A2-3708HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
NR4A2-3707HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR4A2 Products
Required fields are marked with *
My Review for All NR4A2 Products
Required fields are marked with *
0
Inquiry Basket