Recombinant Human NR4A2 Protein (1-598 aa), His-tagged
Cat.No. : | NR4A2-2451H |
Product Overview : | Recombinant Human NR4A2 Protein (1-598 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-598 aa |
Description : | Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. It is crucial for expression of a set of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 68.6 kDa |
AA Sequence : | MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | NR4A2 nuclear receptor subfamily 4, group A, member 2 [ Homo sapiens ] |
Official Symbol | NR4A2 |
Synonyms | NR4A2; NURR1; HZF 3; NOT; RNR1; TINUR; nuclear receptor related 1; HZF-3; |
Gene ID | 4929 |
mRNA Refseq | NM_006186 |
Protein Refseq | NP_006177 |
MIM | 601828 |
UniProt ID | P43354 |
◆ Recombinant Proteins | ||
NR4A2-6190M | Recombinant Mouse NR4A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NR4A2-3543H | Recombinant Human NR4A2 Protein, His-tagged | +Inquiry |
NR4A2-114H | Recombinant Human nuclear receptor subfamily 4, group A, member 2 Protein, His tagged | +Inquiry |
NR4A2-371HFL | Recombinant Full Length Human NR4A2 Protein, C-Flag-tagged | +Inquiry |
NR4A2-10872M | Recombinant Mouse NR4A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NR4A2-3707HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
NR4A2-3708HCL | Recombinant Human NR4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR4A2 Products
Required fields are marked with *
My Review for All NR4A2 Products
Required fields are marked with *
0
Inquiry Basket